Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166D3G3

Protein Details
Accession A0A166D3G3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
318-346SMSAKSVRSSRSRTPRRRRVSGRDSIRLLHydrophilic
NLS Segment(s)
PositionSequence
328-336RSRTPRRRR
Subcellular Location(s) mito 17, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQPSLSIKLALPRPSLRPHLEPSVRDQPRMNLLPRATTFTAGRGAEKIIKSVSRVFRRSKSVSTTSSPDLFVARVVEAVSSNTSPIDATAESASTNEVHDEPASIFQEKASIAPPTAQAPAPVCRCNSCGSEVMHETNTIPFPSTSAPVTLPIAQTASTPSRPVLRRMPMMSFRALGLGRMMQRKLSSVTRLSSLMPSASFVTARTSISRSPSETSVHQELDGEAENFNTTKFPSNITDLSALMDTYLDFTPSDSWQSDAFWQLPPVSSTVLVSVSPAAPPSSPVPHAALVQDSMFLRPGPRTMTPQTVPGGSPFFGSMSAKSVRSSRSRTPRRRRVSGRDSIRLLAPTFATPPRGSVLPMTSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.53
4 0.52
5 0.53
6 0.58
7 0.59
8 0.55
9 0.57
10 0.6
11 0.57
12 0.54
13 0.51
14 0.45
15 0.49
16 0.53
17 0.48
18 0.44
19 0.43
20 0.47
21 0.46
22 0.49
23 0.4
24 0.37
25 0.35
26 0.3
27 0.35
28 0.28
29 0.28
30 0.22
31 0.24
32 0.27
33 0.27
34 0.26
35 0.24
36 0.24
37 0.26
38 0.33
39 0.39
40 0.42
41 0.48
42 0.53
43 0.56
44 0.63
45 0.65
46 0.63
47 0.61
48 0.58
49 0.57
50 0.54
51 0.53
52 0.49
53 0.46
54 0.4
55 0.33
56 0.28
57 0.23
58 0.19
59 0.16
60 0.11
61 0.1
62 0.09
63 0.09
64 0.08
65 0.1
66 0.11
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.08
73 0.1
74 0.07
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.08
82 0.08
83 0.08
84 0.08
85 0.09
86 0.09
87 0.1
88 0.09
89 0.13
90 0.14
91 0.14
92 0.13
93 0.12
94 0.14
95 0.13
96 0.13
97 0.11
98 0.1
99 0.1
100 0.11
101 0.13
102 0.12
103 0.14
104 0.13
105 0.13
106 0.15
107 0.2
108 0.22
109 0.24
110 0.23
111 0.23
112 0.24
113 0.26
114 0.25
115 0.22
116 0.23
117 0.21
118 0.24
119 0.25
120 0.25
121 0.23
122 0.21
123 0.19
124 0.16
125 0.16
126 0.13
127 0.11
128 0.09
129 0.1
130 0.11
131 0.12
132 0.1
133 0.11
134 0.11
135 0.11
136 0.12
137 0.13
138 0.12
139 0.11
140 0.11
141 0.09
142 0.09
143 0.11
144 0.13
145 0.11
146 0.12
147 0.12
148 0.19
149 0.2
150 0.24
151 0.28
152 0.29
153 0.33
154 0.34
155 0.37
156 0.35
157 0.36
158 0.33
159 0.26
160 0.22
161 0.21
162 0.19
163 0.14
164 0.1
165 0.11
166 0.12
167 0.15
168 0.15
169 0.14
170 0.14
171 0.15
172 0.17
173 0.17
174 0.18
175 0.17
176 0.18
177 0.19
178 0.19
179 0.19
180 0.17
181 0.15
182 0.12
183 0.1
184 0.1
185 0.09
186 0.08
187 0.08
188 0.07
189 0.1
190 0.1
191 0.11
192 0.11
193 0.13
194 0.14
195 0.18
196 0.19
197 0.19
198 0.2
199 0.21
200 0.22
201 0.22
202 0.25
203 0.25
204 0.23
205 0.21
206 0.19
207 0.17
208 0.17
209 0.16
210 0.11
211 0.08
212 0.08
213 0.08
214 0.08
215 0.08
216 0.07
217 0.06
218 0.11
219 0.11
220 0.14
221 0.16
222 0.2
223 0.2
224 0.22
225 0.22
226 0.17
227 0.18
228 0.15
229 0.13
230 0.09
231 0.08
232 0.06
233 0.07
234 0.07
235 0.07
236 0.07
237 0.07
238 0.09
239 0.1
240 0.13
241 0.11
242 0.12
243 0.12
244 0.13
245 0.14
246 0.15
247 0.16
248 0.14
249 0.15
250 0.14
251 0.15
252 0.14
253 0.14
254 0.12
255 0.11
256 0.1
257 0.1
258 0.1
259 0.09
260 0.09
261 0.09
262 0.08
263 0.08
264 0.09
265 0.09
266 0.08
267 0.1
268 0.13
269 0.16
270 0.17
271 0.19
272 0.21
273 0.21
274 0.22
275 0.21
276 0.19
277 0.16
278 0.15
279 0.15
280 0.13
281 0.12
282 0.12
283 0.12
284 0.12
285 0.12
286 0.14
287 0.17
288 0.19
289 0.25
290 0.28
291 0.36
292 0.35
293 0.38
294 0.38
295 0.35
296 0.33
297 0.29
298 0.28
299 0.2
300 0.2
301 0.16
302 0.14
303 0.14
304 0.15
305 0.13
306 0.15
307 0.18
308 0.18
309 0.19
310 0.23
311 0.27
312 0.34
313 0.4
314 0.45
315 0.54
316 0.64
317 0.74
318 0.81
319 0.86
320 0.88
321 0.92
322 0.91
323 0.91
324 0.9
325 0.89
326 0.87
327 0.85
328 0.78
329 0.7
330 0.64
331 0.56
332 0.47
333 0.39
334 0.31
335 0.24
336 0.25
337 0.25
338 0.26
339 0.24
340 0.25
341 0.26
342 0.25
343 0.24
344 0.25