Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166IU94

Protein Details
Accession A0A166IU94    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-50VDPNSCRKRRRTYVCMRDVTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 3.5, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MYTAEPSLIIWTLHDLLSLHTNGSAENWLVDPNSCRKRRRTYVCMRDVTTHLADSLTGLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.14
5 0.14
6 0.11
7 0.1
8 0.11
9 0.1
10 0.1
11 0.1
12 0.06
13 0.07
14 0.07
15 0.06
16 0.07
17 0.07
18 0.08
19 0.15
20 0.24
21 0.3
22 0.34
23 0.41
24 0.5
25 0.6
26 0.68
27 0.7
28 0.73
29 0.78
30 0.83
31 0.81
32 0.73
33 0.67
34 0.6
35 0.55
36 0.45
37 0.35
38 0.26
39 0.21
40 0.19