Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166FWH6

Protein Details
Accession A0A166FWH6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-94AAHRWRVRGTRTQRKRQLGRREHRACVBasic
NLS Segment(s)
PositionSequence
73-88RVRGTRTQRKRQLGRR
Subcellular Location(s) mito 11, extr 9, cyto 3, nucl 2, pero 2
Family & Domain DBs
Amino Acid Sequences MLYAFYHSQCCTVCILHLSSTAPPSFILSRKPHARNPCKVSAFQHLLKTRVRIALTPPQPERPVTAPAAHRWRVRGTRTQRKRQLGRREHRACV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.17
4 0.18
5 0.18
6 0.17
7 0.2
8 0.18
9 0.16
10 0.14
11 0.16
12 0.17
13 0.17
14 0.23
15 0.24
16 0.31
17 0.4
18 0.44
19 0.48
20 0.56
21 0.63
22 0.64
23 0.67
24 0.68
25 0.62
26 0.59
27 0.56
28 0.53
29 0.5
30 0.43
31 0.43
32 0.37
33 0.37
34 0.36
35 0.35
36 0.29
37 0.27
38 0.25
39 0.19
40 0.21
41 0.28
42 0.31
43 0.35
44 0.35
45 0.36
46 0.36
47 0.36
48 0.35
49 0.29
50 0.28
51 0.24
52 0.27
53 0.26
54 0.31
55 0.39
56 0.4
57 0.39
58 0.38
59 0.44
60 0.46
61 0.49
62 0.52
63 0.55
64 0.61
65 0.7
66 0.78
67 0.8
68 0.84
69 0.89
70 0.89
71 0.89
72 0.89
73 0.89
74 0.9