Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YA78

Protein Details
Accession A0A165YA78   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
10-35GSSSPSTRPSKHRRSCVRGRRAKDTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 13.333, nucl 4
Family & Domain DBs
Amino Acid Sequences MWRLSRLHIGSSSPSTRPSKHRRSCVRGRRAKDTLRMVFVQAATRTRVLPSSSVWDSSHTRVTGEVASEVDNVDRIPRSMRVPFAKGCSASVRQHGRCGSVHVLHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.38
4 0.46
5 0.52
6 0.57
7 0.62
8 0.72
9 0.76
10 0.8
11 0.86
12 0.87
13 0.87
14 0.85
15 0.82
16 0.8
17 0.77
18 0.74
19 0.71
20 0.69
21 0.62
22 0.56
23 0.51
24 0.43
25 0.38
26 0.33
27 0.28
28 0.2
29 0.19
30 0.16
31 0.16
32 0.16
33 0.14
34 0.15
35 0.13
36 0.12
37 0.12
38 0.16
39 0.15
40 0.17
41 0.17
42 0.18
43 0.2
44 0.21
45 0.23
46 0.18
47 0.17
48 0.16
49 0.17
50 0.14
51 0.12
52 0.11
53 0.08
54 0.09
55 0.09
56 0.09
57 0.07
58 0.07
59 0.06
60 0.07
61 0.07
62 0.07
63 0.1
64 0.12
65 0.16
66 0.19
67 0.26
68 0.29
69 0.33
70 0.35
71 0.38
72 0.4
73 0.37
74 0.36
75 0.35
76 0.35
77 0.35
78 0.41
79 0.45
80 0.42
81 0.49
82 0.48
83 0.46
84 0.42
85 0.44
86 0.42