Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166H3U9

Protein Details
Accession A0A166H3U9   
Localization Confidence High
Confidence Score 23.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-62AAAASQPKRPRGRPKGSKNKKTLEKEAHydrophilic
99-122DGEPAAKKPRGRPRKPKAEDADEGBasic
125-147EGEPVEKPKKRPGRPPKSATTAAHydrophilic
NLS Segment(s)
PositionSequence
42-58PKRPRGRPKGSKNKKTL
85-117APKKRGRPPKAKTEDGEPAAKKPRGRPRKPKAE
128-141PVEKPKKRPGRPPK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MSPSPSSDEIEESAQAVDQLEEGAGDSAAPTAPAPAAAASQPKRPRGRPKGSKNKKTLEKEAAAAAAIASGDPNAIAAAAAETSAPKKRGRPPKAKTEDGEPAAKKPRGRPRKPKAEDADEGGDEGEPVEKPKKRPGRPPKSATTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.08
5 0.06
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.04
13 0.04
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.07
25 0.15
26 0.16
27 0.24
28 0.29
29 0.37
30 0.43
31 0.49
32 0.59
33 0.62
34 0.72
35 0.74
36 0.8
37 0.84
38 0.89
39 0.91
40 0.88
41 0.86
42 0.85
43 0.81
44 0.77
45 0.73
46 0.63
47 0.55
48 0.48
49 0.39
50 0.29
51 0.22
52 0.14
53 0.07
54 0.05
55 0.04
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.03
68 0.02
69 0.03
70 0.05
71 0.08
72 0.11
73 0.12
74 0.18
75 0.27
76 0.38
77 0.48
78 0.57
79 0.59
80 0.68
81 0.74
82 0.74
83 0.67
84 0.62
85 0.6
86 0.52
87 0.53
88 0.42
89 0.39
90 0.43
91 0.44
92 0.41
93 0.42
94 0.5
95 0.55
96 0.65
97 0.71
98 0.74
99 0.82
100 0.85
101 0.86
102 0.83
103 0.8
104 0.73
105 0.67
106 0.6
107 0.49
108 0.44
109 0.34
110 0.25
111 0.17
112 0.15
113 0.11
114 0.06
115 0.1
116 0.18
117 0.22
118 0.26
119 0.37
120 0.47
121 0.54
122 0.65
123 0.73
124 0.76
125 0.82
126 0.86
127 0.85