Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166CY46

Protein Details
Accession A0A166CY46   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-47ADFALDTDHRKRRRNRTTQSCLNCHTSKRKCDRKRPCSRCIQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MLDFADFALDTDHRKRRRNRTTQSCLNCHTSKRKCDRKRPCSRCIQLGLTGLCVYEVDDPAARDDPNVDETTRLRSRIAELESLVRELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.64
4 0.74
5 0.81
6 0.83
7 0.86
8 0.88
9 0.89
10 0.88
11 0.82
12 0.74
13 0.71
14 0.62
15 0.57
16 0.57
17 0.55
18 0.56
19 0.61
20 0.69
21 0.71
22 0.79
23 0.85
24 0.86
25 0.9
26 0.88
27 0.85
28 0.85
29 0.79
30 0.73
31 0.66
32 0.57
33 0.48
34 0.44
35 0.37
36 0.27
37 0.23
38 0.17
39 0.13
40 0.11
41 0.09
42 0.07
43 0.07
44 0.07
45 0.08
46 0.09
47 0.11
48 0.12
49 0.11
50 0.1
51 0.11
52 0.12
53 0.15
54 0.16
55 0.14
56 0.15
57 0.16
58 0.25
59 0.26
60 0.26
61 0.23
62 0.23
63 0.27
64 0.31
65 0.33
66 0.28
67 0.27
68 0.31
69 0.32