Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166AQD0

Protein Details
Accession A0A166AQD0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
107-131AEVEPSRPKKKIRRGLKSRLDVPSSHydrophilic
NLS Segment(s)
PositionSequence
112-124SRPKKKIRRGLKS
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
Amino Acid Sequences MSSDLVDVEGPSIIQSHAKQRGPLGARAILGPLRYGNHDCRPNAVFYAIHDSNAYVLAVERQIRKGEQITVKYSKEGYYRSRCLCFSCTGELTTQLQRPKRAADDAAEVEPSRPKKKIRRGLKSRLDVPSSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.2
4 0.29
5 0.31
6 0.33
7 0.34
8 0.42
9 0.41
10 0.43
11 0.39
12 0.33
13 0.31
14 0.3
15 0.3
16 0.22
17 0.19
18 0.16
19 0.13
20 0.12
21 0.15
22 0.18
23 0.22
24 0.28
25 0.33
26 0.33
27 0.35
28 0.36
29 0.34
30 0.31
31 0.27
32 0.2
33 0.15
34 0.24
35 0.2
36 0.18
37 0.17
38 0.16
39 0.15
40 0.15
41 0.13
42 0.05
43 0.05
44 0.05
45 0.07
46 0.09
47 0.1
48 0.11
49 0.12
50 0.12
51 0.14
52 0.14
53 0.18
54 0.2
55 0.22
56 0.26
57 0.29
58 0.29
59 0.28
60 0.28
61 0.25
62 0.23
63 0.24
64 0.27
65 0.31
66 0.36
67 0.38
68 0.41
69 0.39
70 0.39
71 0.38
72 0.34
73 0.29
74 0.27
75 0.25
76 0.23
77 0.23
78 0.23
79 0.23
80 0.24
81 0.25
82 0.27
83 0.3
84 0.32
85 0.34
86 0.35
87 0.36
88 0.35
89 0.33
90 0.3
91 0.33
92 0.32
93 0.31
94 0.29
95 0.25
96 0.22
97 0.26
98 0.29
99 0.27
100 0.3
101 0.37
102 0.46
103 0.57
104 0.66
105 0.72
106 0.78
107 0.83
108 0.89
109 0.91
110 0.89
111 0.86
112 0.83