Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4KM39

Protein Details
Accession J4KM39   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSSSAFVKSPLRRRRCRRTKQTGSYTLARHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004303  PAD  
IPR013530  PAD_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005509  F:calcium ion binding  
GO:0004668  F:protein-arginine deiminase activity  
Pfam View protein in Pfam  
PF03068  PAD  
Amino Acid Sequences MSSSAFVKSPLRRRRCRRTKQTGSYTLARDAAAHIITDYIEDKLVAYHPAVINGVVFNNGQYLAPNPWGPVVDGADILAAAANKEYAKYGFNITYIDDWFDHHAHAGEVHCATNVARDASQKWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.91
4 0.92
5 0.93
6 0.94
7 0.93
8 0.93
9 0.9
10 0.85
11 0.8
12 0.71
13 0.62
14 0.52
15 0.41
16 0.32
17 0.24
18 0.21
19 0.15
20 0.12
21 0.09
22 0.08
23 0.08
24 0.09
25 0.08
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.07
33 0.06
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.09
58 0.08
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.04
67 0.03
68 0.03
69 0.04
70 0.04
71 0.05
72 0.06
73 0.06
74 0.07
75 0.09
76 0.12
77 0.12
78 0.13
79 0.14
80 0.14
81 0.15
82 0.15
83 0.15
84 0.12
85 0.13
86 0.16
87 0.16
88 0.15
89 0.14
90 0.14
91 0.12
92 0.14
93 0.14
94 0.13
95 0.14
96 0.14
97 0.13
98 0.13
99 0.13
100 0.16
101 0.17
102 0.16
103 0.17
104 0.2