Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166B5H6

Protein Details
Accession A0A166B5H6    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPHTSHydrophilic
NLS Segment(s)
PositionSequence
14-41KKAHRNGIKKPHTSRTRSLKGVDAKFRR
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPHTSRTRSLKGVDAKFRRNQRFALVGSRKARIEQNEAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.83
8 0.82
9 0.8
10 0.77
11 0.77
12 0.75
13 0.71
14 0.7
15 0.69
16 0.66
17 0.61
18 0.56
19 0.53
20 0.52
21 0.52
22 0.53
23 0.49
24 0.48
25 0.52
26 0.6
27 0.6
28 0.56
29 0.52
30 0.48
31 0.48
32 0.44
33 0.48
34 0.44
35 0.46
36 0.46
37 0.48
38 0.44
39 0.42
40 0.46
41 0.4
42 0.42