Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ZA84

Protein Details
Accession A0A165ZA84   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-44IDGTTYRSRFKPKPRRIPPTAPPKPTHydrophilic
NLS Segment(s)
PositionSequence
28-40FKPKPRRIPPTAP
Subcellular Location(s) nucl 20.5, cyto_nucl 15.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MVPPPPKQLGDGTWRVTCIDGTTYRSRFKPKPRRIPPTAPPKPTALTKPATPSPPSLPSPPASIPSPVGANLPPSTLSAATEDATAQDAPMDTSDDVMALEADALNIFPNTPFQPGGQAAQGTCLAHHASVNHTDQFFIQPDVATTTTTVLGMCATRHTPKPSLRLSLPAQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.32
4 0.27
5 0.21
6 0.19
7 0.18
8 0.23
9 0.3
10 0.33
11 0.37
12 0.41
13 0.47
14 0.5
15 0.59
16 0.64
17 0.67
18 0.75
19 0.8
20 0.86
21 0.87
22 0.88
23 0.86
24 0.86
25 0.84
26 0.77
27 0.69
28 0.63
29 0.57
30 0.52
31 0.47
32 0.41
33 0.35
34 0.33
35 0.36
36 0.37
37 0.38
38 0.35
39 0.34
40 0.33
41 0.35
42 0.36
43 0.32
44 0.31
45 0.28
46 0.3
47 0.28
48 0.26
49 0.22
50 0.21
51 0.19
52 0.17
53 0.17
54 0.13
55 0.13
56 0.11
57 0.12
58 0.1
59 0.1
60 0.1
61 0.09
62 0.1
63 0.09
64 0.09
65 0.08
66 0.09
67 0.08
68 0.08
69 0.07
70 0.07
71 0.08
72 0.07
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.05
80 0.05
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.06
97 0.07
98 0.09
99 0.09
100 0.09
101 0.13
102 0.14
103 0.15
104 0.15
105 0.14
106 0.12
107 0.14
108 0.15
109 0.11
110 0.1
111 0.11
112 0.1
113 0.09
114 0.11
115 0.09
116 0.11
117 0.16
118 0.19
119 0.19
120 0.19
121 0.19
122 0.19
123 0.21
124 0.2
125 0.17
126 0.15
127 0.12
128 0.13
129 0.16
130 0.16
131 0.13
132 0.12
133 0.12
134 0.12
135 0.12
136 0.11
137 0.08
138 0.08
139 0.09
140 0.09
141 0.11
142 0.14
143 0.19
144 0.25
145 0.31
146 0.37
147 0.42
148 0.5
149 0.53
150 0.56
151 0.53
152 0.55