Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165Y2H8

Protein Details
Accession A0A165Y2H8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-45RAAGLHIKPRRRSQRRTALMQSNTEQKPRRPQRKSTASQAHydrophilic
NLS Segment(s)
PositionSequence
13-18KPRRRS
Subcellular Location(s) mito 15.5, nucl 10.5, cyto_mito 8.833, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MSFRVRAAGLHIKPRRRSQRRTALMQSNTEQKPRRPQRKSTASQAQLVRQGLAEWKRARSNNREPIAELYRASTHRFLSRFAPNNIHAQRIDEAAPSPLQIEELATGTNGQETINVGAAPVDHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.73
4 0.78
5 0.78
6 0.83
7 0.82
8 0.84
9 0.82
10 0.8
11 0.74
12 0.7
13 0.62
14 0.6
15 0.54
16 0.53
17 0.48
18 0.44
19 0.51
20 0.57
21 0.65
22 0.63
23 0.7
24 0.73
25 0.8
26 0.8
27 0.78
28 0.78
29 0.7
30 0.69
31 0.62
32 0.54
33 0.49
34 0.44
35 0.34
36 0.24
37 0.21
38 0.2
39 0.2
40 0.23
41 0.2
42 0.22
43 0.27
44 0.31
45 0.35
46 0.39
47 0.46
48 0.5
49 0.51
50 0.49
51 0.45
52 0.46
53 0.45
54 0.37
55 0.27
56 0.2
57 0.2
58 0.2
59 0.22
60 0.19
61 0.17
62 0.21
63 0.21
64 0.21
65 0.24
66 0.31
67 0.34
68 0.35
69 0.38
70 0.35
71 0.44
72 0.43
73 0.41
74 0.33
75 0.3
76 0.28
77 0.25
78 0.24
79 0.16
80 0.15
81 0.14
82 0.14
83 0.11
84 0.11
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.08
91 0.08
92 0.07
93 0.08
94 0.07
95 0.08
96 0.07
97 0.06
98 0.06
99 0.08
100 0.1
101 0.11
102 0.1
103 0.1
104 0.1