Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166A564

Protein Details
Accession A0A166A564    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
227-246RRVNLKPCSRSKKRTVIPDDHydrophilic
NLS Segment(s)
PositionSequence
197-219KGKKRMRQRDVDAHPPKKRTKQN
Subcellular Location(s) nucl 10.5, mito 8.5, cyto_nucl 8.333, cyto_mito 7.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000999  RNase_III_dom  
IPR036389  RNase_III_sf  
Gene Ontology GO:0004525  F:ribonuclease III activity  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF00636  Ribonuclease_3  
PROSITE View protein in PROSITE  
PS50142  RNASE_3_2  
CDD cd00593  RIBOc  
Amino Acid Sequences MASLSTNRILNAVLRKICDDDFKASLPKDVPRKEWRAIRQWEQDPHNHNRLEILGDSVLRAGLCSKLFQDDKLDCGVISQLKDVLLSNLVLAMVAEKCDIKLISRTNFHSVLGLVKDLLKRDERGVKVKVAIPRSQFKPIADRYEAVIGALSTRIGMDGACRWVETAFEPLVIAGLEGYNSRTKTMAASTTSNTTWKGKKRMRQRDVDAHPPKKRTKQNAGLSNAGRRVNLKPCSRSKKRTVIPDDAEIIDLTADDILEILDEDNPRQSWGSDGDPIIIDLTGDDSDEEEGLGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.36
4 0.37
5 0.38
6 0.34
7 0.31
8 0.31
9 0.33
10 0.36
11 0.34
12 0.37
13 0.33
14 0.37
15 0.41
16 0.43
17 0.48
18 0.52
19 0.58
20 0.61
21 0.67
22 0.68
23 0.68
24 0.72
25 0.73
26 0.73
27 0.74
28 0.74
29 0.7
30 0.7
31 0.67
32 0.67
33 0.65
34 0.56
35 0.49
36 0.43
37 0.39
38 0.34
39 0.27
40 0.22
41 0.15
42 0.15
43 0.15
44 0.13
45 0.12
46 0.09
47 0.09
48 0.07
49 0.09
50 0.09
51 0.1
52 0.11
53 0.17
54 0.18
55 0.19
56 0.25
57 0.23
58 0.24
59 0.25
60 0.25
61 0.18
62 0.18
63 0.19
64 0.15
65 0.15
66 0.13
67 0.12
68 0.12
69 0.13
70 0.12
71 0.11
72 0.09
73 0.08
74 0.08
75 0.07
76 0.07
77 0.06
78 0.05
79 0.06
80 0.05
81 0.05
82 0.06
83 0.05
84 0.05
85 0.07
86 0.08
87 0.08
88 0.13
89 0.18
90 0.22
91 0.26
92 0.29
93 0.32
94 0.33
95 0.31
96 0.27
97 0.22
98 0.2
99 0.17
100 0.14
101 0.09
102 0.11
103 0.12
104 0.12
105 0.15
106 0.14
107 0.15
108 0.18
109 0.25
110 0.26
111 0.3
112 0.31
113 0.31
114 0.31
115 0.34
116 0.34
117 0.31
118 0.32
119 0.3
120 0.34
121 0.35
122 0.38
123 0.36
124 0.32
125 0.36
126 0.35
127 0.36
128 0.31
129 0.29
130 0.25
131 0.25
132 0.24
133 0.17
134 0.14
135 0.08
136 0.07
137 0.06
138 0.05
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.05
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.08
152 0.08
153 0.1
154 0.08
155 0.08
156 0.08
157 0.07
158 0.08
159 0.07
160 0.06
161 0.03
162 0.03
163 0.03
164 0.03
165 0.06
166 0.08
167 0.09
168 0.09
169 0.1
170 0.1
171 0.11
172 0.13
173 0.15
174 0.15
175 0.17
176 0.18
177 0.2
178 0.21
179 0.21
180 0.21
181 0.22
182 0.25
183 0.31
184 0.4
185 0.43
186 0.5
187 0.6
188 0.7
189 0.73
190 0.76
191 0.77
192 0.77
193 0.77
194 0.8
195 0.79
196 0.76
197 0.74
198 0.72
199 0.71
200 0.7
201 0.73
202 0.71
203 0.72
204 0.74
205 0.77
206 0.8
207 0.77
208 0.75
209 0.68
210 0.63
211 0.58
212 0.48
213 0.4
214 0.33
215 0.33
216 0.35
217 0.41
218 0.43
219 0.45
220 0.55
221 0.65
222 0.72
223 0.75
224 0.76
225 0.78
226 0.78
227 0.81
228 0.78
229 0.77
230 0.73
231 0.68
232 0.62
233 0.52
234 0.46
235 0.35
236 0.27
237 0.17
238 0.13
239 0.09
240 0.06
241 0.05
242 0.04
243 0.04
244 0.03
245 0.03
246 0.04
247 0.04
248 0.07
249 0.08
250 0.09
251 0.13
252 0.14
253 0.15
254 0.16
255 0.16
256 0.16
257 0.19
258 0.21
259 0.22
260 0.22
261 0.23
262 0.22
263 0.22
264 0.2
265 0.16
266 0.12
267 0.08
268 0.09
269 0.08
270 0.08
271 0.07
272 0.08
273 0.09
274 0.09