Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166KR99

Protein Details
Accession A0A166KR99    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-72SSSGGRVRKRQRTGYQPTSTHydrophilic
NLS Segment(s)
PositionSequence
58-61RVRK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MSAIRTRWLRSSQVRQECPYMKCFADDWATRALVRQYMRNSRATSTKRKSAGSSSGGRVRKRQRTGYQPTSTMDDDDEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.65
3 0.68
4 0.67
5 0.6
6 0.53
7 0.46
8 0.37
9 0.33
10 0.31
11 0.26
12 0.26
13 0.24
14 0.22
15 0.22
16 0.22
17 0.2
18 0.21
19 0.19
20 0.17
21 0.17
22 0.2
23 0.22
24 0.3
25 0.32
26 0.35
27 0.35
28 0.33
29 0.4
30 0.4
31 0.45
32 0.43
33 0.47
34 0.46
35 0.47
36 0.47
37 0.44
38 0.45
39 0.4
40 0.39
41 0.37
42 0.42
43 0.46
44 0.45
45 0.49
46 0.52
47 0.57
48 0.6
49 0.65
50 0.66
51 0.71
52 0.79
53 0.8
54 0.76
55 0.7
56 0.65
57 0.61
58 0.53
59 0.44
60 0.36