Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AFH5

Protein Details
Accession A0A166AFH5   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-60RASAEDQRREKRRREFGAKMDKEBasic
NLS Segment(s)
PositionSequence
46-51REKRRR
156-161EKRRRA
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Amino Acid Sequences MPPTPGMFAVPHSSQRPRNGDADYYLHPSTSMGAGPSRASAEDQRREKRRREFGAKMDKEMNDRRGESRTYVDNIQSLHNTSLQLSSRPETSSAFLLQVYPLSLQRSALLVQHELEEHAALEAAQQMFDMERARVEDEYKRGRERVRERMLEGIEEKRRRAREERDGDALGDAAAGGALDAQTRPGATRKLRGKLASPPPQDMPQPAMGAATGAPSNPHSLAIDELPSAFPLPLTAVTLPQSGQGAQGAQGQNRRRAKGAGGPPQPAFGMLGKSVLSLTGCKESEIEADLSDITRGNKRRRTAAGGSGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.54
4 0.52
5 0.54
6 0.52
7 0.5
8 0.47
9 0.45
10 0.39
11 0.39
12 0.35
13 0.3
14 0.26
15 0.23
16 0.2
17 0.17
18 0.15
19 0.1
20 0.11
21 0.13
22 0.13
23 0.14
24 0.14
25 0.13
26 0.15
27 0.22
28 0.3
29 0.38
30 0.46
31 0.54
32 0.63
33 0.7
34 0.76
35 0.78
36 0.79
37 0.8
38 0.8
39 0.79
40 0.79
41 0.84
42 0.77
43 0.71
44 0.67
45 0.59
46 0.57
47 0.55
48 0.51
49 0.45
50 0.44
51 0.42
52 0.4
53 0.41
54 0.36
55 0.33
56 0.32
57 0.3
58 0.3
59 0.29
60 0.27
61 0.26
62 0.26
63 0.23
64 0.21
65 0.19
66 0.18
67 0.17
68 0.16
69 0.19
70 0.18
71 0.19
72 0.19
73 0.19
74 0.19
75 0.2
76 0.2
77 0.17
78 0.18
79 0.18
80 0.16
81 0.15
82 0.13
83 0.13
84 0.12
85 0.11
86 0.1
87 0.08
88 0.09
89 0.1
90 0.1
91 0.1
92 0.11
93 0.12
94 0.12
95 0.13
96 0.13
97 0.12
98 0.12
99 0.12
100 0.12
101 0.11
102 0.1
103 0.08
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.08
117 0.05
118 0.06
119 0.07
120 0.08
121 0.09
122 0.11
123 0.13
124 0.18
125 0.24
126 0.27
127 0.28
128 0.3
129 0.32
130 0.39
131 0.43
132 0.48
133 0.49
134 0.48
135 0.47
136 0.49
137 0.47
138 0.39
139 0.34
140 0.29
141 0.28
142 0.28
143 0.28
144 0.28
145 0.3
146 0.33
147 0.38
148 0.39
149 0.43
150 0.48
151 0.5
152 0.49
153 0.47
154 0.43
155 0.36
156 0.29
157 0.18
158 0.11
159 0.07
160 0.03
161 0.03
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.03
169 0.03
170 0.04
171 0.05
172 0.08
173 0.13
174 0.15
175 0.24
176 0.3
177 0.36
178 0.4
179 0.4
180 0.41
181 0.45
182 0.53
183 0.54
184 0.5
185 0.48
186 0.46
187 0.47
188 0.45
189 0.37
190 0.3
191 0.23
192 0.21
193 0.18
194 0.15
195 0.13
196 0.12
197 0.1
198 0.08
199 0.05
200 0.05
201 0.06
202 0.07
203 0.09
204 0.09
205 0.1
206 0.09
207 0.1
208 0.11
209 0.11
210 0.12
211 0.09
212 0.1
213 0.09
214 0.09
215 0.09
216 0.07
217 0.06
218 0.06
219 0.07
220 0.07
221 0.09
222 0.09
223 0.1
224 0.11
225 0.12
226 0.12
227 0.12
228 0.12
229 0.1
230 0.11
231 0.1
232 0.09
233 0.1
234 0.16
235 0.17
236 0.19
237 0.26
238 0.3
239 0.38
240 0.44
241 0.45
242 0.41
243 0.41
244 0.42
245 0.45
246 0.5
247 0.51
248 0.5
249 0.52
250 0.5
251 0.49
252 0.45
253 0.36
254 0.29
255 0.2
256 0.17
257 0.13
258 0.14
259 0.13
260 0.13
261 0.13
262 0.12
263 0.11
264 0.09
265 0.12
266 0.18
267 0.18
268 0.18
269 0.19
270 0.19
271 0.2
272 0.22
273 0.2
274 0.13
275 0.14
276 0.14
277 0.14
278 0.13
279 0.13
280 0.13
281 0.2
282 0.28
283 0.37
284 0.44
285 0.48
286 0.56
287 0.61
288 0.67
289 0.65
290 0.67