Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166DLL5

Protein Details
Accession A0A166DLL5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
322-348DLLHIRPIIRRRRQRLKHQEAVQNRERHydrophilic
NLS Segment(s)
PositionSequence
331-336RRRRQR
Subcellular Location(s) plas 24, extr 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001499  GPCR_STE3  
Gene Ontology GO:0016020  C:membrane  
GO:0004932  F:mating-type factor pheromone receptor activity  
Pfam View protein in Pfam  
PF02076  STE3  
Amino Acid Sequences MGKPVDPSYPLYPIACVFAATGLFLVLLTSFVRSRWNLGVSFLCFWLFLENLTFAVNSVVWADNGDIKHPVYCDLASHLQTICYVVKPAATLIMTRRLYLIASFRNMEMHTTLKRSDLIIEWFLGLGLPLLVAGPIYYIIQTRRFTILEGFGPSGSSSHTVLAILLFYQWSISLPLISIVLYFPKVVWIFYRQSRDMSDFFLRSNSNSSTSRSGYLRLFALASVDMLATFPVGIVNVALVIVRNLDSRRSLPFYDGWTATHRNWAPHSSPYSDVLAKGRSGLAQFYFSNWVTPVLSLIIFALFGTTLNARKAYMTVLCWFGDLLHIRPIIRRRRQRLKHQEAVQNRERTRRGLGSGPQEITLDSQLWSRELSFADFELTAPAGQRIDAKDDAEARKSEDSGRDAIKVYSGPGDSTPALTPPKSDSDKPEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.17
4 0.14
5 0.13
6 0.13
7 0.11
8 0.1
9 0.07
10 0.07
11 0.06
12 0.06
13 0.04
14 0.05
15 0.06
16 0.08
17 0.08
18 0.09
19 0.15
20 0.16
21 0.2
22 0.24
23 0.28
24 0.26
25 0.29
26 0.33
27 0.31
28 0.32
29 0.28
30 0.23
31 0.19
32 0.19
33 0.18
34 0.14
35 0.11
36 0.12
37 0.11
38 0.12
39 0.12
40 0.12
41 0.09
42 0.1
43 0.1
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.1
50 0.13
51 0.14
52 0.15
53 0.15
54 0.15
55 0.17
56 0.17
57 0.18
58 0.16
59 0.16
60 0.15
61 0.19
62 0.23
63 0.22
64 0.24
65 0.22
66 0.2
67 0.2
68 0.22
69 0.18
70 0.14
71 0.14
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.11
78 0.12
79 0.14
80 0.23
81 0.23
82 0.23
83 0.23
84 0.21
85 0.21
86 0.21
87 0.24
88 0.18
89 0.21
90 0.21
91 0.21
92 0.23
93 0.23
94 0.22
95 0.18
96 0.18
97 0.18
98 0.2
99 0.2
100 0.2
101 0.2
102 0.19
103 0.19
104 0.18
105 0.2
106 0.18
107 0.18
108 0.16
109 0.15
110 0.14
111 0.12
112 0.09
113 0.05
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.02
121 0.03
122 0.03
123 0.04
124 0.04
125 0.06
126 0.08
127 0.14
128 0.15
129 0.17
130 0.2
131 0.2
132 0.21
133 0.21
134 0.22
135 0.18
136 0.19
137 0.18
138 0.15
139 0.15
140 0.14
141 0.12
142 0.1
143 0.1
144 0.08
145 0.08
146 0.08
147 0.08
148 0.08
149 0.08
150 0.07
151 0.05
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.05
166 0.04
167 0.05
168 0.06
169 0.06
170 0.05
171 0.09
172 0.09
173 0.09
174 0.1
175 0.14
176 0.17
177 0.22
178 0.27
179 0.24
180 0.26
181 0.27
182 0.29
183 0.26
184 0.26
185 0.25
186 0.2
187 0.19
188 0.2
189 0.19
190 0.16
191 0.19
192 0.16
193 0.17
194 0.17
195 0.2
196 0.21
197 0.22
198 0.23
199 0.2
200 0.22
201 0.19
202 0.19
203 0.17
204 0.13
205 0.12
206 0.1
207 0.1
208 0.07
209 0.06
210 0.05
211 0.05
212 0.04
213 0.04
214 0.04
215 0.03
216 0.03
217 0.03
218 0.02
219 0.03
220 0.03
221 0.02
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.02
228 0.03
229 0.04
230 0.06
231 0.06
232 0.08
233 0.09
234 0.11
235 0.14
236 0.18
237 0.18
238 0.18
239 0.2
240 0.22
241 0.24
242 0.23
243 0.21
244 0.22
245 0.25
246 0.23
247 0.28
248 0.26
249 0.25
250 0.27
251 0.29
252 0.27
253 0.29
254 0.32
255 0.27
256 0.28
257 0.27
258 0.28
259 0.25
260 0.24
261 0.21
262 0.19
263 0.16
264 0.15
265 0.14
266 0.12
267 0.12
268 0.12
269 0.11
270 0.13
271 0.13
272 0.14
273 0.18
274 0.17
275 0.17
276 0.16
277 0.16
278 0.13
279 0.13
280 0.12
281 0.09
282 0.08
283 0.07
284 0.07
285 0.06
286 0.05
287 0.05
288 0.05
289 0.03
290 0.04
291 0.05
292 0.07
293 0.09
294 0.1
295 0.11
296 0.11
297 0.11
298 0.12
299 0.13
300 0.14
301 0.14
302 0.15
303 0.17
304 0.17
305 0.16
306 0.16
307 0.13
308 0.16
309 0.15
310 0.15
311 0.17
312 0.18
313 0.19
314 0.24
315 0.32
316 0.38
317 0.46
318 0.55
319 0.6
320 0.7
321 0.79
322 0.86
323 0.89
324 0.89
325 0.88
326 0.86
327 0.85
328 0.82
329 0.81
330 0.79
331 0.76
332 0.69
333 0.68
334 0.61
335 0.56
336 0.54
337 0.49
338 0.44
339 0.42
340 0.46
341 0.46
342 0.49
343 0.47
344 0.41
345 0.37
346 0.34
347 0.29
348 0.24
349 0.17
350 0.12
351 0.13
352 0.13
353 0.14
354 0.14
355 0.13
356 0.14
357 0.14
358 0.16
359 0.15
360 0.14
361 0.16
362 0.15
363 0.15
364 0.14
365 0.13
366 0.11
367 0.11
368 0.12
369 0.1
370 0.11
371 0.15
372 0.15
373 0.2
374 0.21
375 0.21
376 0.23
377 0.3
378 0.33
379 0.34
380 0.33
381 0.31
382 0.32
383 0.33
384 0.34
385 0.32
386 0.32
387 0.33
388 0.34
389 0.33
390 0.32
391 0.31
392 0.29
393 0.24
394 0.22
395 0.21
396 0.2
397 0.19
398 0.18
399 0.22
400 0.2
401 0.22
402 0.21
403 0.21
404 0.24
405 0.23
406 0.24
407 0.24
408 0.33
409 0.36
410 0.39