Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0W8T5

Protein Details
Accession G0W8T5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-39FNKNIEKHRKYGKKKLNKNDEKSQLHydrophilic
NLS Segment(s)
PositionSequence
19-30IEKHRKYGKKKL
Subcellular Location(s) nucl 10, plas 5, E.R. 5, golg 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG ndi:NDAI_0C05370  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAIQTPKQRIANEKFNKNIEKHRKYGKKKLNKNDEKSQLPISKVWLAVILFLLIGGGVLELISFFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.66
4 0.61
5 0.64
6 0.64
7 0.61
8 0.6
9 0.65
10 0.69
11 0.71
12 0.78
13 0.78
14 0.77
15 0.81
16 0.85
17 0.86
18 0.85
19 0.84
20 0.83
21 0.8
22 0.72
23 0.65
24 0.61
25 0.53
26 0.45
27 0.39
28 0.33
29 0.29
30 0.26
31 0.23
32 0.19
33 0.15
34 0.14
35 0.14
36 0.1
37 0.07
38 0.06
39 0.06
40 0.03
41 0.03
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02