Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ZEI3

Protein Details
Accession A0A165ZEI3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-50NYRFFCPYCRLRHRQRKNLDAKTWHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, E.R. 4, golg 3, mito 2, cyto 1, plas 1, vacu 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR041078  Plavaka  
Pfam View protein in Pfam  
PF18759  Plavaka  
Amino Acid Sequences VLVRAALFLVICDTPAARQVSGFGAPNYRFFCPYCRLRHRQRKNLDAKTWPPRTSEHHRDCAERWKQARSDNEREKIYAESGVRYSALLELPYWDPSRFTVIDIMHLLFEGNLKRYLRIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.14
3 0.16
4 0.13
5 0.13
6 0.15
7 0.17
8 0.19
9 0.2
10 0.16
11 0.2
12 0.2
13 0.25
14 0.27
15 0.25
16 0.25
17 0.24
18 0.28
19 0.29
20 0.35
21 0.4
22 0.47
23 0.54
24 0.63
25 0.73
26 0.79
27 0.82
28 0.83
29 0.84
30 0.85
31 0.85
32 0.79
33 0.74
34 0.71
35 0.71
36 0.68
37 0.59
38 0.5
39 0.45
40 0.47
41 0.5
42 0.53
43 0.48
44 0.5
45 0.51
46 0.51
47 0.5
48 0.53
49 0.48
50 0.44
51 0.4
52 0.37
53 0.38
54 0.42
55 0.49
56 0.48
57 0.54
58 0.55
59 0.59
60 0.55
61 0.53
62 0.48
63 0.41
64 0.33
65 0.27
66 0.19
67 0.16
68 0.15
69 0.15
70 0.14
71 0.13
72 0.12
73 0.1
74 0.1
75 0.08
76 0.08
77 0.1
78 0.11
79 0.14
80 0.16
81 0.15
82 0.15
83 0.16
84 0.21
85 0.19
86 0.19
87 0.21
88 0.19
89 0.22
90 0.23
91 0.23
92 0.17
93 0.17
94 0.16
95 0.11
96 0.14
97 0.13
98 0.14
99 0.19
100 0.2