Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166LUB5

Protein Details
Accession A0A166LUB5   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSRVMTTRSKHRAQRQKRQNTAPKGKSVHydrophilic
NLS Segment(s)
PositionSequence
10-63KHRAQRQKRQNTAPKGKSVPEGRSVPEGKSVPEGKSVPEGKSVPEGKHHTRRRK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSRVMTTRSKHRAQRQKRQNTAPKGKSVPEGRSVPEGKSVPEGKSVPEGKSVPEGKHHTRRRKIVLLPSGRGISAGVLVSAHGGRGTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.88
4 0.89
5 0.91
6 0.9
7 0.9
8 0.9
9 0.83
10 0.8
11 0.72
12 0.65
13 0.61
14 0.57
15 0.49
16 0.45
17 0.42
18 0.36
19 0.39
20 0.38
21 0.31
22 0.32
23 0.29
24 0.23
25 0.27
26 0.27
27 0.21
28 0.24
29 0.24
30 0.19
31 0.24
32 0.26
33 0.21
34 0.23
35 0.23
36 0.19
37 0.26
38 0.27
39 0.22
40 0.27
41 0.32
42 0.35
43 0.45
44 0.54
45 0.58
46 0.64
47 0.71
48 0.72
49 0.73
50 0.72
51 0.71
52 0.71
53 0.67
54 0.61
55 0.57
56 0.5
57 0.42
58 0.36
59 0.27
60 0.18
61 0.13
62 0.11
63 0.07
64 0.06
65 0.06
66 0.08
67 0.08
68 0.08
69 0.06