Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165XXX9

Protein Details
Accession A0A165XXX9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-101AASARFRIKKKQKTLNLERTVHydrophilic
NLS Segment(s)
PositionSequence
76-91RRRNTAASARFRIKKK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MPSPPTSFVVPSQPPHRSHHSSQSLGHGGHSLSEASASASGSASTSLAVVHDTPSPVNQEGTPPTDPEGGVIEDKRRRNTAASARFRIKKKQKTLNLERTVNDLSGRVEELEHEASELRRENGWLKEIVMLKSRQRVEGLSLPDPPSGPPDEGDEGDDKDKDEDKEDRGEGSSTGKTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.56
4 0.55
5 0.56
6 0.61
7 0.61
8 0.58
9 0.56
10 0.58
11 0.54
12 0.46
13 0.41
14 0.32
15 0.24
16 0.22
17 0.2
18 0.13
19 0.08
20 0.08
21 0.08
22 0.07
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.08
39 0.08
40 0.09
41 0.1
42 0.13
43 0.13
44 0.13
45 0.12
46 0.14
47 0.16
48 0.2
49 0.19
50 0.17
51 0.18
52 0.18
53 0.17
54 0.15
55 0.15
56 0.11
57 0.12
58 0.12
59 0.16
60 0.21
61 0.25
62 0.26
63 0.26
64 0.27
65 0.28
66 0.34
67 0.38
68 0.42
69 0.46
70 0.48
71 0.52
72 0.57
73 0.57
74 0.6
75 0.6
76 0.59
77 0.61
78 0.66
79 0.69
80 0.73
81 0.8
82 0.81
83 0.78
84 0.72
85 0.63
86 0.58
87 0.5
88 0.41
89 0.31
90 0.21
91 0.14
92 0.12
93 0.12
94 0.08
95 0.07
96 0.07
97 0.1
98 0.1
99 0.09
100 0.09
101 0.09
102 0.09
103 0.12
104 0.13
105 0.11
106 0.11
107 0.13
108 0.16
109 0.18
110 0.2
111 0.18
112 0.17
113 0.21
114 0.24
115 0.24
116 0.25
117 0.25
118 0.27
119 0.34
120 0.34
121 0.31
122 0.29
123 0.29
124 0.3
125 0.33
126 0.35
127 0.29
128 0.32
129 0.32
130 0.31
131 0.3
132 0.25
133 0.23
134 0.2
135 0.19
136 0.16
137 0.19
138 0.21
139 0.21
140 0.23
141 0.22
142 0.21
143 0.23
144 0.23
145 0.19
146 0.19
147 0.22
148 0.21
149 0.24
150 0.26
151 0.27
152 0.33
153 0.33
154 0.32
155 0.3
156 0.3
157 0.26
158 0.26