Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0W5G2

Protein Details
Accession G0W5G2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-35ARSNSLHRRRLPTGRKIRKPKNHTNKNNVIKQSHydrophilic
NLS Segment(s)
PositionSequence
9-42HRRRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKI
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
KEGG ndi:NDAI_0A00160  -  
Amino Acid Sequences MAARSNSLHRRRLPTGRKIRKPKNHTNKNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.81
4 0.85
5 0.87
6 0.91
7 0.91
8 0.91
9 0.91
10 0.91
11 0.92
12 0.91
13 0.9
14 0.9
15 0.89
16 0.87
17 0.8
18 0.73
19 0.68
20 0.67
21 0.68
22 0.68
23 0.66
24 0.68
25 0.73
26 0.77
27 0.79
28 0.79
29 0.74
30 0.74
31 0.75
32 0.75
33 0.68
34 0.61
35 0.53
36 0.45
37 0.4
38 0.33
39 0.26
40 0.17
41 0.14
42 0.14
43 0.13
44 0.13
45 0.14
46 0.11
47 0.09
48 0.09
49 0.09
50 0.09
51 0.1
52 0.09
53 0.12
54 0.17
55 0.2
56 0.23
57 0.26
58 0.34
59 0.43
60 0.48
61 0.51
62 0.48
63 0.46
64 0.44
65 0.43
66 0.38
67 0.31
68 0.29
69 0.23
70 0.21
71 0.2
72 0.21
73 0.23
74 0.27
75 0.25
76 0.21
77 0.2
78 0.21
79 0.22
80 0.24
81 0.29
82 0.28
83 0.36
84 0.42
85 0.43
86 0.44
87 0.45
88 0.45
89 0.46
90 0.47
91 0.42
92 0.41
93 0.41
94 0.48
95 0.51
96 0.5
97 0.48
98 0.43
99 0.4
100 0.35
101 0.33
102 0.27
103 0.23