Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YQ33

Protein Details
Accession A0A165YQ33   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-167TSGSAPSKSKKRKVVPVGEDHydrophilic
169-195ELEKAIDKKLGKKKKKPKIGLSFADDAHydrophilic
NLS Segment(s)
PositionSequence
103-161KRKAKGLPPLPRPASPSANPGEEDKAKAEPAPKKERDSKKGLSFSTSGSAPSKSKKRKV
172-186KAIDKKLGKKKKKPK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKEPTKAQLSSRLTYSSGTQPAFLRRLQNKIAGTADSEEEEDEEFEDDGSGRPPIPRRPAIPERPAEERGSDDEDDRDEAPQIVVLKEGKHLSGWEVENEKRKAKGLPPLPRPASPSANPGEEDKAKAEPAPKKERDSKKGLSFSTSGSAPSKSKKRKVVPVGEDDELEKAIDKKLGKKKKKPKIGLSFADDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.34
4 0.34
5 0.31
6 0.31
7 0.29
8 0.29
9 0.29
10 0.34
11 0.36
12 0.35
13 0.37
14 0.35
15 0.41
16 0.42
17 0.46
18 0.41
19 0.42
20 0.41
21 0.32
22 0.3
23 0.25
24 0.23
25 0.17
26 0.16
27 0.13
28 0.11
29 0.11
30 0.09
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.07
41 0.11
42 0.15
43 0.21
44 0.28
45 0.32
46 0.34
47 0.42
48 0.51
49 0.56
50 0.59
51 0.56
52 0.53
53 0.54
54 0.54
55 0.46
56 0.37
57 0.31
58 0.27
59 0.26
60 0.23
61 0.19
62 0.17
63 0.16
64 0.17
65 0.16
66 0.13
67 0.09
68 0.09
69 0.08
70 0.09
71 0.09
72 0.07
73 0.08
74 0.09
75 0.08
76 0.11
77 0.11
78 0.1
79 0.09
80 0.09
81 0.09
82 0.12
83 0.12
84 0.12
85 0.15
86 0.17
87 0.24
88 0.26
89 0.27
90 0.23
91 0.24
92 0.25
93 0.25
94 0.31
95 0.33
96 0.4
97 0.44
98 0.52
99 0.53
100 0.52
101 0.52
102 0.48
103 0.45
104 0.36
105 0.35
106 0.29
107 0.28
108 0.28
109 0.25
110 0.25
111 0.21
112 0.21
113 0.18
114 0.17
115 0.16
116 0.17
117 0.22
118 0.24
119 0.31
120 0.39
121 0.41
122 0.46
123 0.56
124 0.64
125 0.64
126 0.66
127 0.66
128 0.65
129 0.68
130 0.62
131 0.56
132 0.48
133 0.43
134 0.38
135 0.3
136 0.24
137 0.19
138 0.21
139 0.2
140 0.27
141 0.35
142 0.42
143 0.5
144 0.58
145 0.64
146 0.72
147 0.79
148 0.82
149 0.79
150 0.78
151 0.74
152 0.66
153 0.58
154 0.48
155 0.39
156 0.29
157 0.22
158 0.15
159 0.11
160 0.12
161 0.16
162 0.17
163 0.26
164 0.36
165 0.47
166 0.56
167 0.66
168 0.75
169 0.82
170 0.9
171 0.91
172 0.92
173 0.92
174 0.91
175 0.88
176 0.84