Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166FWD6

Protein Details
Accession A0A166FWD6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-38KTPWRLSRTRKANVRDRLKKBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto_mito 12.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSFGAFRPTSIASSGLLWKTPWRLSRTRKANVRDRLKKVDAVIEAVRASGVECGALERALELPKEHEMEPRDKYTVFSKWDRGYRKGIHKMPKFTRVTQRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.18
4 0.17
5 0.19
6 0.23
7 0.27
8 0.31
9 0.32
10 0.4
11 0.48
12 0.58
13 0.64
14 0.68
15 0.71
16 0.73
17 0.76
18 0.78
19 0.8
20 0.79
21 0.77
22 0.76
23 0.7
24 0.65
25 0.56
26 0.51
27 0.4
28 0.34
29 0.28
30 0.21
31 0.19
32 0.16
33 0.14
34 0.09
35 0.09
36 0.05
37 0.05
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.06
47 0.07
48 0.06
49 0.08
50 0.1
51 0.13
52 0.13
53 0.16
54 0.18
55 0.23
56 0.26
57 0.27
58 0.27
59 0.25
60 0.27
61 0.27
62 0.29
63 0.3
64 0.3
65 0.34
66 0.38
67 0.45
68 0.49
69 0.49
70 0.51
71 0.54
72 0.6
73 0.64
74 0.66
75 0.69
76 0.71
77 0.77
78 0.76
79 0.78
80 0.73
81 0.7
82 0.74
83 0.71
84 0.72
85 0.72
86 0.76