Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165XLW1

Protein Details
Accession A0A165XLW1   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
99-124YDWIRLTEKQKIPKPRKKADKVELTDHydrophilic
NLS Segment(s)
PositionSequence
109-116KIPKPRKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVQIVNAMTVKQEIGSPMACAHLLGHPDHYTNYKFRPFYWRMFVGEVKRAWGQLSPDNKHEEPSVMVTRKNDESEALVALSPVLDYEMRPPELANMTLYDWIRLTEKQKIPKPRKKADKVELTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.11
5 0.12
6 0.12
7 0.11
8 0.11
9 0.11
10 0.12
11 0.12
12 0.15
13 0.15
14 0.16
15 0.18
16 0.2
17 0.2
18 0.22
19 0.26
20 0.3
21 0.29
22 0.3
23 0.38
24 0.39
25 0.41
26 0.44
27 0.42
28 0.37
29 0.4
30 0.42
31 0.36
32 0.37
33 0.32
34 0.28
35 0.25
36 0.23
37 0.21
38 0.18
39 0.18
40 0.19
41 0.26
42 0.26
43 0.28
44 0.33
45 0.32
46 0.32
47 0.3
48 0.24
49 0.17
50 0.19
51 0.22
52 0.18
53 0.19
54 0.18
55 0.21
56 0.22
57 0.22
58 0.18
59 0.14
60 0.14
61 0.14
62 0.14
63 0.11
64 0.09
65 0.08
66 0.07
67 0.07
68 0.05
69 0.03
70 0.04
71 0.04
72 0.04
73 0.09
74 0.13
75 0.14
76 0.14
77 0.14
78 0.16
79 0.19
80 0.19
81 0.16
82 0.13
83 0.14
84 0.18
85 0.18
86 0.16
87 0.14
88 0.14
89 0.16
90 0.18
91 0.21
92 0.27
93 0.33
94 0.42
95 0.5
96 0.6
97 0.68
98 0.75
99 0.81
100 0.82
101 0.87
102 0.87
103 0.9
104 0.89