Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166B2N2

Protein Details
Accession A0A166B2N2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-91EPDESVPSRRRRRRDTRRYRLPVLPBasic
NLS Segment(s)
PositionSequence
75-83RRRRRRDTR
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGANAPRVQLVRDPKPLPEEKSAPPDEESNDNVTTVARAPPRARRALGGGTDQVSPAGGSTANSTDEPDESVPSRRRRRRDTRRYRLPVLPEPSLLEAHFKRRTCTVHTCNSDEFNSKCRSGDFHVKYHFQKHIGKYWNTHKRCHVDCPGYPYLGAAAWAAIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.55
4 0.53
5 0.52
6 0.49
7 0.46
8 0.53
9 0.52
10 0.46
11 0.43
12 0.4
13 0.35
14 0.34
15 0.31
16 0.27
17 0.25
18 0.23
19 0.21
20 0.18
21 0.16
22 0.14
23 0.16
24 0.14
25 0.18
26 0.21
27 0.3
28 0.36
29 0.4
30 0.39
31 0.37
32 0.39
33 0.39
34 0.38
35 0.32
36 0.28
37 0.24
38 0.23
39 0.21
40 0.17
41 0.12
42 0.1
43 0.07
44 0.06
45 0.04
46 0.04
47 0.06
48 0.07
49 0.08
50 0.09
51 0.09
52 0.09
53 0.09
54 0.1
55 0.09
56 0.1
57 0.1
58 0.16
59 0.22
60 0.3
61 0.4
62 0.46
63 0.53
64 0.62
65 0.72
66 0.77
67 0.82
68 0.85
69 0.86
70 0.9
71 0.89
72 0.84
73 0.77
74 0.72
75 0.68
76 0.61
77 0.51
78 0.4
79 0.35
80 0.31
81 0.27
82 0.21
83 0.18
84 0.14
85 0.21
86 0.26
87 0.25
88 0.26
89 0.3
90 0.33
91 0.34
92 0.43
93 0.42
94 0.45
95 0.49
96 0.51
97 0.48
98 0.48
99 0.44
100 0.38
101 0.34
102 0.3
103 0.3
104 0.27
105 0.26
106 0.24
107 0.26
108 0.27
109 0.37
110 0.35
111 0.38
112 0.43
113 0.48
114 0.51
115 0.53
116 0.51
117 0.46
118 0.5
119 0.47
120 0.51
121 0.54
122 0.54
123 0.54
124 0.61
125 0.66
126 0.61
127 0.63
128 0.63
129 0.63
130 0.64
131 0.65
132 0.64
133 0.61
134 0.62
135 0.65
136 0.6
137 0.52
138 0.48
139 0.4
140 0.31
141 0.23
142 0.2
143 0.12