Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165Y1T0

Protein Details
Accession A0A165Y1T0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
162-185SRSQPLRAPRARKRQKDSPTQGSLHydrophilic
NLS Segment(s)
PositionSequence
170-175PRARKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
CDD cd18809  SF1_C_RecD  
Amino Acid Sequences MTAHKAQGRTLPRVIIDLDNCRGTEAPYVMISRVKSLAGLLILRPFPRKKISSRQSEESRNEFARLDQLSLSTLAEYGTDRERDLASAKLRACRNPFPSAPAFTTRLGNNDSSANAVLRTFQVAVATAARSELSSLERSRIRRPEPALDGSLLLAPAVAPISRSQPLRAPRARKRQKDSPTQGSLAQGAVGRDAHMPLDSDRDHDGDGLVQAPMQSRMRKRGLQDNTTGRQLKRPRLESNSDDMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.32
5 0.33
6 0.32
7 0.31
8 0.3
9 0.28
10 0.24
11 0.25
12 0.2
13 0.18
14 0.18
15 0.19
16 0.19
17 0.22
18 0.21
19 0.19
20 0.19
21 0.16
22 0.14
23 0.14
24 0.14
25 0.13
26 0.13
27 0.11
28 0.15
29 0.17
30 0.18
31 0.24
32 0.24
33 0.27
34 0.34
35 0.37
36 0.4
37 0.5
38 0.58
39 0.62
40 0.68
41 0.72
42 0.72
43 0.76
44 0.74
45 0.68
46 0.64
47 0.55
48 0.49
49 0.41
50 0.34
51 0.31
52 0.26
53 0.22
54 0.17
55 0.16
56 0.15
57 0.15
58 0.15
59 0.09
60 0.08
61 0.06
62 0.07
63 0.07
64 0.08
65 0.1
66 0.1
67 0.11
68 0.12
69 0.12
70 0.12
71 0.14
72 0.16
73 0.15
74 0.2
75 0.21
76 0.26
77 0.28
78 0.32
79 0.36
80 0.38
81 0.41
82 0.41
83 0.4
84 0.39
85 0.4
86 0.38
87 0.35
88 0.32
89 0.3
90 0.25
91 0.27
92 0.22
93 0.22
94 0.21
95 0.19
96 0.16
97 0.14
98 0.13
99 0.12
100 0.12
101 0.1
102 0.08
103 0.07
104 0.07
105 0.06
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.07
121 0.1
122 0.1
123 0.14
124 0.18
125 0.2
126 0.27
127 0.33
128 0.34
129 0.37
130 0.41
131 0.43
132 0.44
133 0.45
134 0.4
135 0.33
136 0.3
137 0.24
138 0.21
139 0.14
140 0.09
141 0.06
142 0.04
143 0.04
144 0.04
145 0.03
146 0.04
147 0.05
148 0.09
149 0.12
150 0.13
151 0.14
152 0.2
153 0.26
154 0.34
155 0.41
156 0.47
157 0.53
158 0.64
159 0.73
160 0.76
161 0.79
162 0.8
163 0.82
164 0.83
165 0.83
166 0.8
167 0.75
168 0.68
169 0.61
170 0.52
171 0.44
172 0.33
173 0.25
174 0.18
175 0.13
176 0.12
177 0.11
178 0.1
179 0.1
180 0.1
181 0.1
182 0.09
183 0.1
184 0.09
185 0.15
186 0.14
187 0.16
188 0.18
189 0.18
190 0.18
191 0.17
192 0.17
193 0.12
194 0.12
195 0.11
196 0.09
197 0.08
198 0.08
199 0.1
200 0.14
201 0.18
202 0.24
203 0.29
204 0.37
205 0.43
206 0.48
207 0.51
208 0.57
209 0.61
210 0.6
211 0.64
212 0.65
213 0.63
214 0.66
215 0.67
216 0.58
217 0.58
218 0.6
219 0.61
220 0.63
221 0.65
222 0.65
223 0.67
224 0.75
225 0.7