Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166A2Z1

Protein Details
Accession A0A166A2Z1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
88-114VLTKSSSRSDREKKRVERRRSSVRGVVHydrophilic
NLS Segment(s)
PositionSequence
98-107REKKRVERRR
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSLHGPFDPPVAASSPSPPAYSMSKPPPSHLKYPPEPPRSAFSGVYMPTLAMDGSVGVRSMRQRKSTQASSGQESHSTTQRALQLSGVLTKSSSRSDREKKRVERRRSSVRGVVDLLARTIAGND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.22
4 0.22
5 0.21
6 0.21
7 0.24
8 0.27
9 0.31
10 0.34
11 0.42
12 0.42
13 0.45
14 0.52
15 0.53
16 0.57
17 0.57
18 0.57
19 0.54
20 0.63
21 0.69
22 0.65
23 0.62
24 0.57
25 0.53
26 0.49
27 0.47
28 0.37
29 0.29
30 0.26
31 0.25
32 0.23
33 0.19
34 0.15
35 0.11
36 0.11
37 0.09
38 0.05
39 0.04
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.09
47 0.17
48 0.2
49 0.24
50 0.26
51 0.31
52 0.38
53 0.41
54 0.41
55 0.42
56 0.41
57 0.4
58 0.41
59 0.36
60 0.31
61 0.29
62 0.27
63 0.23
64 0.21
65 0.17
66 0.19
67 0.22
68 0.21
69 0.2
70 0.19
71 0.16
72 0.16
73 0.19
74 0.16
75 0.12
76 0.11
77 0.12
78 0.13
79 0.17
80 0.19
81 0.2
82 0.29
83 0.4
84 0.5
85 0.59
86 0.67
87 0.73
88 0.81
89 0.88
90 0.89
91 0.89
92 0.88
93 0.89
94 0.86
95 0.83
96 0.78
97 0.72
98 0.65
99 0.56
100 0.49
101 0.42
102 0.35
103 0.28
104 0.22
105 0.18