Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165WW98

Protein Details
Accession A0A165WW98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-37VAIREWRWWWARRRSRRTRIPARQRRTSGSHydrophilic
NLS Segment(s)
PositionSequence
18-33ARRRSRRTRIPARQRR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGCRGGWVAIREWRWWWARRRSRRTRIPARQRRTSGSRASQAATSVCHLVLAIVGPKSTTHSAVPPRCVVDVALKGSTRAPTRWSLDIYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.46
4 0.51
5 0.59
6 0.69
7 0.78
8 0.82
9 0.86
10 0.9
11 0.91
12 0.91
13 0.92
14 0.92
15 0.92
16 0.89
17 0.87
18 0.81
19 0.77
20 0.71
21 0.66
22 0.62
23 0.57
24 0.54
25 0.46
26 0.43
27 0.37
28 0.31
29 0.26
30 0.19
31 0.15
32 0.11
33 0.09
34 0.08
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.09
45 0.11
46 0.12
47 0.11
48 0.17
49 0.26
50 0.3
51 0.34
52 0.32
53 0.33
54 0.32
55 0.31
56 0.27
57 0.24
58 0.24
59 0.24
60 0.25
61 0.23
62 0.24
63 0.26
64 0.3
65 0.27
66 0.24
67 0.25
68 0.29
69 0.33
70 0.37