Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166CTB4

Protein Details
Accession A0A166CTB4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25AHTHRRNRARKDKNKPPRPANSFMIHydrophilic
NLS Segment(s)
PositionSequence
5-19RRNRARKDKNKPPRP
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences AHTHRRNRARKDKNKPPRPANSFMIYRSEKSKELKLLGNQQAEGSKTISQMWKAEPEDVKREYEIKQAEAKAVHASLYPNYQYKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.91
4 0.9
5 0.87
6 0.82
7 0.76
8 0.71
9 0.63
10 0.54
11 0.52
12 0.44
13 0.38
14 0.36
15 0.34
16 0.31
17 0.32
18 0.35
19 0.32
20 0.32
21 0.35
22 0.35
23 0.41
24 0.43
25 0.4
26 0.36
27 0.32
28 0.3
29 0.27
30 0.24
31 0.16
32 0.11
33 0.1
34 0.12
35 0.13
36 0.13
37 0.14
38 0.15
39 0.19
40 0.19
41 0.23
42 0.25
43 0.27
44 0.32
45 0.32
46 0.32
47 0.27
48 0.29
49 0.26
50 0.3
51 0.28
52 0.25
53 0.29
54 0.28
55 0.3
56 0.29
57 0.28
58 0.24
59 0.22
60 0.2
61 0.16
62 0.17
63 0.16
64 0.21
65 0.23