Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YU00

Protein Details
Accession A0A165YU00   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
38-63SSSGGKSAKKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
40-58SGGKSAKKKKWSKGKVKDK
Subcellular Location(s) mito 18.5, cyto_mito 11.833, cyto_nucl 4.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MRLDRSGGERMARAVLRIFIFANSLDPQAKAKAAAPTSSSGGKSAKKKKWSKGKVKDKAQHAVTPDKVLFDRIVKEVPTFRFISQSILIERLRVNGSLARIAIRHLEKEGSIKRIVHHHGQLIYTRASAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.2
4 0.2
5 0.19
6 0.14
7 0.15
8 0.14
9 0.16
10 0.13
11 0.15
12 0.14
13 0.14
14 0.16
15 0.16
16 0.16
17 0.15
18 0.16
19 0.19
20 0.2
21 0.21
22 0.2
23 0.21
24 0.23
25 0.24
26 0.21
27 0.17
28 0.2
29 0.24
30 0.31
31 0.39
32 0.44
33 0.52
34 0.6
35 0.67
36 0.75
37 0.8
38 0.82
39 0.83
40 0.87
41 0.87
42 0.89
43 0.86
44 0.8
45 0.77
46 0.68
47 0.6
48 0.52
49 0.47
50 0.38
51 0.33
52 0.28
53 0.21
54 0.19
55 0.17
56 0.15
57 0.11
58 0.13
59 0.12
60 0.13
61 0.12
62 0.14
63 0.17
64 0.17
65 0.2
66 0.2
67 0.18
68 0.2
69 0.2
70 0.23
71 0.2
72 0.2
73 0.18
74 0.2
75 0.2
76 0.18
77 0.18
78 0.17
79 0.16
80 0.15
81 0.15
82 0.14
83 0.15
84 0.16
85 0.16
86 0.14
87 0.13
88 0.14
89 0.19
90 0.18
91 0.18
92 0.18
93 0.19
94 0.19
95 0.27
96 0.3
97 0.28
98 0.3
99 0.3
100 0.31
101 0.38
102 0.42
103 0.41
104 0.41
105 0.42
106 0.41
107 0.42
108 0.43
109 0.39
110 0.35
111 0.28