Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166LGJ8

Protein Details
Accession A0A166LGJ8    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
223-242VGDRRDKLLEENKDKKRRRGBasic
NLS Segment(s)
PositionSequence
155-162KKPGRRKS
235-242KDKKRRRG
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011421  BCNT-C  
IPR027124  Swc5/CFDP1/2  
Gene Ontology GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
Pfam View protein in Pfam  
PF07572  BCNT  
PROSITE View protein in PROSITE  
PS51279  BCNT_C  
Amino Acid Sequences MAATAHVINGSDSEDDPDYIPGNDPSPSASDDERDAKRRRTESVTLENAAEDETARKQARDKAWADLQASMVAPPPNIDLERKKTVKIRKTHRFAGEDVSEVVEVAEDSEDAKKWPLWDPSADSSVDKSPRLPASSDEAGSSTSTQAPASVAPLKKPGRRKSRIQLGDIPSTASQKAKKLTTIEKSAMDWRAHSQSDAQLKDDLDANRRGGGYLEKVQFLNDVGDRRDKLLEENKDKKRRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.16
5 0.16
6 0.15
7 0.17
8 0.15
9 0.15
10 0.15
11 0.14
12 0.14
13 0.15
14 0.16
15 0.17
16 0.16
17 0.17
18 0.2
19 0.27
20 0.31
21 0.37
22 0.41
23 0.46
24 0.54
25 0.55
26 0.56
27 0.56
28 0.58
29 0.57
30 0.61
31 0.58
32 0.51
33 0.48
34 0.43
35 0.35
36 0.29
37 0.21
38 0.12
39 0.09
40 0.09
41 0.16
42 0.16
43 0.17
44 0.21
45 0.28
46 0.33
47 0.39
48 0.39
49 0.39
50 0.43
51 0.46
52 0.44
53 0.37
54 0.32
55 0.26
56 0.24
57 0.18
58 0.16
59 0.12
60 0.11
61 0.1
62 0.1
63 0.11
64 0.12
65 0.15
66 0.18
67 0.24
68 0.32
69 0.33
70 0.35
71 0.4
72 0.48
73 0.52
74 0.56
75 0.6
76 0.62
77 0.68
78 0.72
79 0.72
80 0.65
81 0.59
82 0.56
83 0.46
84 0.37
85 0.3
86 0.23
87 0.17
88 0.14
89 0.12
90 0.06
91 0.05
92 0.04
93 0.04
94 0.03
95 0.04
96 0.04
97 0.05
98 0.05
99 0.07
100 0.07
101 0.09
102 0.13
103 0.15
104 0.16
105 0.17
106 0.2
107 0.22
108 0.23
109 0.22
110 0.18
111 0.16
112 0.19
113 0.19
114 0.16
115 0.14
116 0.16
117 0.18
118 0.19
119 0.18
120 0.16
121 0.21
122 0.22
123 0.22
124 0.18
125 0.17
126 0.16
127 0.16
128 0.14
129 0.09
130 0.08
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.09
137 0.14
138 0.14
139 0.15
140 0.23
141 0.28
142 0.32
143 0.42
144 0.48
145 0.53
146 0.59
147 0.67
148 0.69
149 0.75
150 0.75
151 0.71
152 0.7
153 0.64
154 0.63
155 0.54
156 0.46
157 0.36
158 0.32
159 0.28
160 0.23
161 0.21
162 0.21
163 0.26
164 0.25
165 0.28
166 0.32
167 0.39
168 0.42
169 0.46
170 0.44
171 0.41
172 0.41
173 0.43
174 0.43
175 0.36
176 0.3
177 0.29
178 0.31
179 0.3
180 0.28
181 0.25
182 0.27
183 0.34
184 0.34
185 0.31
186 0.29
187 0.28
188 0.29
189 0.32
190 0.27
191 0.24
192 0.27
193 0.26
194 0.26
195 0.26
196 0.25
197 0.21
198 0.23
199 0.24
200 0.28
201 0.29
202 0.28
203 0.28
204 0.28
205 0.28
206 0.25
207 0.24
208 0.19
209 0.2
210 0.21
211 0.28
212 0.29
213 0.3
214 0.32
215 0.29
216 0.33
217 0.39
218 0.46
219 0.5
220 0.59
221 0.67
222 0.75