Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166B8Z3

Protein Details
Accession A0A166B8Z3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-50PCDPKTQCCKRAHNRVDERDVQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, E.R. 5, plas 4, pero 2
Family & Domain DBs
Amino Acid Sequences MQFKLIASLVVFVIFGLVAATPTPLLVDPCDPKTQCCKRAHNRVDERDVQLMVRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.03
9 0.04
10 0.04
11 0.04
12 0.05
13 0.05
14 0.08
15 0.1
16 0.13
17 0.18
18 0.17
19 0.19
20 0.29
21 0.37
22 0.43
23 0.48
24 0.56
25 0.61
26 0.73
27 0.78
28 0.79
29 0.81
30 0.8
31 0.8
32 0.76
33 0.7
34 0.63
35 0.56