Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5JVY3

Protein Details
Accession J5JVY3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-36IPKTRNTYCKGKECRKHTQHKVTQYKAHydrophilic
78-98LECVKCKTKCQLALKRCKHFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVCACNPVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKTKCQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.59
4 0.61
5 0.68
6 0.7
7 0.72
8 0.75
9 0.76
10 0.82
11 0.81
12 0.84
13 0.84
14 0.85
15 0.83
16 0.85
17 0.87
18 0.79
19 0.79
20 0.72
21 0.67
22 0.59
23 0.54
24 0.43
25 0.35
26 0.33
27 0.33
28 0.31
29 0.28
30 0.33
31 0.37
32 0.41
33 0.46
34 0.5
35 0.47
36 0.53
37 0.6
38 0.58
39 0.59
40 0.58
41 0.57
42 0.55
43 0.57
44 0.48
45 0.43
46 0.4
47 0.33
48 0.35
49 0.37
50 0.36
51 0.31
52 0.38
53 0.42
54 0.51
55 0.59
56 0.62
57 0.62
58 0.65
59 0.72
60 0.73
61 0.71
62 0.67
63 0.64
64 0.65
65 0.65
66 0.63
67 0.59
68 0.59
69 0.53
70 0.54
71 0.55
72 0.54
73 0.56
74 0.6
75 0.66
76 0.68
77 0.77
78 0.8
79 0.83
80 0.79
81 0.73
82 0.66
83 0.57
84 0.55
85 0.55
86 0.54
87 0.53
88 0.54
89 0.52
90 0.49
91 0.49
92 0.42