Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166ESP2

Protein Details
Accession A0A166ESP2    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSTRSKVKRAHRAKKREDSVYAHydrophilic
NLS Segment(s)
PositionSequence
6-18RSKVKRAHRAKKR
100-145THGPRNSRREAWRISKGMAARPKARGMNRQGGIASKTKPGRPQRRR
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSTRSKVKRAHRAKKREDSVYAAVEAARLQRLNAKLVGLTTQDPPTEEVSEDEEGGEDEKMQDDAPEAGPSKAAGKTVSGAAEIMDIDPSATPKKISTHGPRNSRREAWRISKGMAARPKARGMNRQGGIASKTKPGRPQRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.92
4 0.89
5 0.85
6 0.77
7 0.73
8 0.68
9 0.59
10 0.49
11 0.38
12 0.31
13 0.24
14 0.21
15 0.15
16 0.13
17 0.1
18 0.1
19 0.15
20 0.17
21 0.2
22 0.2
23 0.19
24 0.17
25 0.17
26 0.18
27 0.14
28 0.14
29 0.14
30 0.15
31 0.15
32 0.15
33 0.16
34 0.17
35 0.16
36 0.15
37 0.13
38 0.15
39 0.15
40 0.14
41 0.12
42 0.1
43 0.09
44 0.09
45 0.08
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.08
56 0.09
57 0.08
58 0.08
59 0.09
60 0.1
61 0.09
62 0.09
63 0.08
64 0.07
65 0.08
66 0.09
67 0.09
68 0.08
69 0.07
70 0.06
71 0.06
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.06
79 0.07
80 0.07
81 0.08
82 0.09
83 0.12
84 0.15
85 0.24
86 0.32
87 0.41
88 0.49
89 0.58
90 0.66
91 0.7
92 0.73
93 0.71
94 0.67
95 0.64
96 0.64
97 0.62
98 0.61
99 0.57
100 0.52
101 0.5
102 0.46
103 0.47
104 0.47
105 0.45
106 0.41
107 0.42
108 0.47
109 0.5
110 0.53
111 0.54
112 0.55
113 0.59
114 0.55
115 0.54
116 0.48
117 0.45
118 0.43
119 0.39
120 0.34
121 0.32
122 0.36
123 0.38
124 0.47
125 0.54