Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165WLC4

Protein Details
Accession A0A165WLC4   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-33NTTASGRQKYRMDRRTRKRVEGSVVHydrophilic
NLS Segment(s)
PositionSequence
87-92GKAGKA
103-113KQKKRGERGKG
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MQSSNKFTNTTASGRQKYRMDRRTRKRVEGSVVPVSRWRGLGIENEETEGSSVARGGREGAKTRWQRDGWRMGSMRMNGDMKLANKGKAGKAGSRLAHECELKQKKRGERGKGEGEEGREEGRGDDGGEKTTLLSIKTGSRQRITRRVCEAGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.57
4 0.63
5 0.69
6 0.69
7 0.71
8 0.74
9 0.82
10 0.87
11 0.88
12 0.87
13 0.84
14 0.8
15 0.77
16 0.73
17 0.69
18 0.67
19 0.6
20 0.51
21 0.47
22 0.43
23 0.37
24 0.3
25 0.24
26 0.15
27 0.16
28 0.21
29 0.23
30 0.23
31 0.22
32 0.23
33 0.22
34 0.21
35 0.19
36 0.14
37 0.09
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.08
44 0.11
45 0.14
46 0.17
47 0.19
48 0.27
49 0.32
50 0.35
51 0.4
52 0.39
53 0.4
54 0.43
55 0.5
56 0.42
57 0.43
58 0.41
59 0.36
60 0.38
61 0.34
62 0.29
63 0.22
64 0.21
65 0.15
66 0.15
67 0.16
68 0.13
69 0.18
70 0.19
71 0.17
72 0.18
73 0.21
74 0.2
75 0.24
76 0.25
77 0.21
78 0.24
79 0.29
80 0.28
81 0.29
82 0.3
83 0.27
84 0.3
85 0.28
86 0.24
87 0.3
88 0.38
89 0.37
90 0.43
91 0.46
92 0.49
93 0.59
94 0.66
95 0.65
96 0.65
97 0.69
98 0.72
99 0.67
100 0.64
101 0.56
102 0.5
103 0.43
104 0.35
105 0.29
106 0.2
107 0.19
108 0.15
109 0.14
110 0.11
111 0.1
112 0.13
113 0.13
114 0.14
115 0.14
116 0.13
117 0.12
118 0.15
119 0.15
120 0.12
121 0.12
122 0.12
123 0.16
124 0.24
125 0.31
126 0.34
127 0.4
128 0.46
129 0.55
130 0.63
131 0.65
132 0.65
133 0.66
134 0.66