Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166CQA4

Protein Details
Accession A0A166CQA4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
93-115PGGKAEKVRLRKENRARIREQNFHydrophilic
NLS Segment(s)
PositionSequence
98-107EKVRLRKENR
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSVLACLRRPPQLARAWSVTRTYAKKVEAAAPPRKVVIPQVPEGALSTCRPTTPLVGINYLKDQEEVLALADEEYPPWLWDLLKPKVLPDDGPGGKAEKVRLRKENRARIREQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.48
4 0.47
5 0.45
6 0.41
7 0.4
8 0.39
9 0.39
10 0.37
11 0.35
12 0.36
13 0.36
14 0.38
15 0.38
16 0.43
17 0.46
18 0.43
19 0.43
20 0.41
21 0.39
22 0.33
23 0.31
24 0.3
25 0.26
26 0.25
27 0.26
28 0.25
29 0.25
30 0.25
31 0.21
32 0.15
33 0.12
34 0.12
35 0.11
36 0.1
37 0.12
38 0.12
39 0.12
40 0.13
41 0.17
42 0.16
43 0.19
44 0.2
45 0.19
46 0.19
47 0.18
48 0.16
49 0.12
50 0.1
51 0.07
52 0.07
53 0.06
54 0.05
55 0.05
56 0.04
57 0.05
58 0.05
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.1
68 0.17
69 0.2
70 0.25
71 0.25
72 0.25
73 0.29
74 0.3
75 0.26
76 0.22
77 0.27
78 0.23
79 0.24
80 0.24
81 0.22
82 0.23
83 0.25
84 0.27
85 0.26
86 0.34
87 0.41
88 0.5
89 0.56
90 0.64
91 0.73
92 0.79
93 0.82
94 0.81
95 0.8
96 0.81
97 0.79
98 0.78
99 0.74