Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165XT08

Protein Details
Accession A0A165XT08    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-35AIDAPKNKKKSAKNKVNKPKAPANSDHydrophilic
NLS Segment(s)
PositionSequence
14-30PKNKKKSAKNKVNKPKA
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MFWERGDRWAIDAPKNKKKSAKNKVNKPKAPANSDVEEPNASSSSGEGSDSDAEDPTVASTPVRGRAQMKTGKNNIVWEYFIDAGVLPDKFGDMSSTPRVMQDYIGRMRSAWICFCFCAGDWKAIELGEYRFNTFLHNKSSKKSADRRLRLEQGRARYAFQGQHNTLYKLEAHDDNEASAPSKKRSKTEPVSKSALDALSESALDYVEDGAPSQTTPAPTFSSPEATTRSTPSAAFNVPIPTSIEAVEPTSTPMEIDDPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.66
4 0.67
5 0.72
6 0.75
7 0.77
8 0.79
9 0.8
10 0.86
11 0.92
12 0.94
13 0.9
14 0.86
15 0.85
16 0.82
17 0.77
18 0.72
19 0.67
20 0.59
21 0.55
22 0.49
23 0.42
24 0.34
25 0.28
26 0.23
27 0.18
28 0.15
29 0.12
30 0.11
31 0.1
32 0.1
33 0.1
34 0.08
35 0.1
36 0.11
37 0.12
38 0.12
39 0.1
40 0.1
41 0.1
42 0.09
43 0.08
44 0.08
45 0.07
46 0.06
47 0.09
48 0.11
49 0.18
50 0.19
51 0.2
52 0.22
53 0.26
54 0.33
55 0.39
56 0.43
57 0.45
58 0.49
59 0.52
60 0.5
61 0.51
62 0.45
63 0.39
64 0.33
65 0.25
66 0.23
67 0.18
68 0.16
69 0.13
70 0.1
71 0.09
72 0.1
73 0.1
74 0.07
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.06
81 0.11
82 0.13
83 0.15
84 0.15
85 0.16
86 0.17
87 0.15
88 0.16
89 0.16
90 0.19
91 0.21
92 0.22
93 0.21
94 0.2
95 0.22
96 0.23
97 0.21
98 0.17
99 0.16
100 0.16
101 0.16
102 0.16
103 0.14
104 0.12
105 0.17
106 0.15
107 0.16
108 0.15
109 0.16
110 0.16
111 0.15
112 0.15
113 0.1
114 0.1
115 0.12
116 0.13
117 0.13
118 0.13
119 0.13
120 0.16
121 0.17
122 0.18
123 0.2
124 0.26
125 0.27
126 0.28
127 0.34
128 0.35
129 0.4
130 0.46
131 0.49
132 0.53
133 0.59
134 0.64
135 0.65
136 0.69
137 0.65
138 0.65
139 0.59
140 0.54
141 0.54
142 0.48
143 0.43
144 0.36
145 0.36
146 0.32
147 0.31
148 0.33
149 0.28
150 0.34
151 0.35
152 0.35
153 0.32
154 0.28
155 0.25
156 0.19
157 0.21
158 0.16
159 0.16
160 0.17
161 0.17
162 0.16
163 0.16
164 0.15
165 0.14
166 0.16
167 0.17
168 0.2
169 0.26
170 0.28
171 0.32
172 0.38
173 0.47
174 0.53
175 0.61
176 0.63
177 0.62
178 0.65
179 0.61
180 0.55
181 0.48
182 0.38
183 0.28
184 0.21
185 0.16
186 0.12
187 0.12
188 0.1
189 0.07
190 0.07
191 0.06
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.07
198 0.07
199 0.07
200 0.08
201 0.09
202 0.11
203 0.12
204 0.15
205 0.18
206 0.18
207 0.21
208 0.21
209 0.25
210 0.23
211 0.25
212 0.27
213 0.27
214 0.28
215 0.3
216 0.31
217 0.27
218 0.27
219 0.27
220 0.28
221 0.25
222 0.25
223 0.23
224 0.24
225 0.23
226 0.23
227 0.22
228 0.19
229 0.19
230 0.18
231 0.17
232 0.14
233 0.16
234 0.16
235 0.13
236 0.14
237 0.14
238 0.14
239 0.13
240 0.13