Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4KM22

Protein Details
Accession J4KM22    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-129GYLSRKRTRTGRAILKRRRQKGRAKLGCHBasic
NLS Segment(s)
PositionSequence
97-125KRRHGYLSRKRTRTGRAILKRRRQKGRAK
Subcellular Location(s) mito 22, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MQALARIARPVLTCKALPIRTFTTLSPVRPSLYANPLRRPSAMTAFTPLPSTTATATAVDVVAPGAISAHPALAGGASQIRCGPRNTMNGATRLVQKRRHGYLSRKRTRTGRAILKRRRQKGRAKLGCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.36
3 0.37
4 0.36
5 0.37
6 0.37
7 0.38
8 0.39
9 0.35
10 0.35
11 0.34
12 0.35
13 0.34
14 0.31
15 0.28
16 0.27
17 0.3
18 0.26
19 0.31
20 0.38
21 0.37
22 0.44
23 0.47
24 0.48
25 0.46
26 0.43
27 0.38
28 0.36
29 0.34
30 0.27
31 0.27
32 0.26
33 0.26
34 0.24
35 0.2
36 0.15
37 0.13
38 0.13
39 0.1
40 0.1
41 0.1
42 0.09
43 0.09
44 0.08
45 0.07
46 0.06
47 0.05
48 0.04
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.06
64 0.06
65 0.06
66 0.08
67 0.1
68 0.12
69 0.13
70 0.17
71 0.19
72 0.24
73 0.28
74 0.33
75 0.34
76 0.34
77 0.35
78 0.33
79 0.36
80 0.39
81 0.41
82 0.41
83 0.46
84 0.51
85 0.54
86 0.61
87 0.6
88 0.63
89 0.69
90 0.73
91 0.76
92 0.73
93 0.73
94 0.72
95 0.73
96 0.71
97 0.7
98 0.7
99 0.7
100 0.77
101 0.82
102 0.86
103 0.88
104 0.89
105 0.9
106 0.88
107 0.88
108 0.88
109 0.89