Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165X956

Protein Details
Accession A0A165X956    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-28VDCASKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MATVDCASKQCRKHTPHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQMSLKRCKHFELGGEKKTKGAALTFLVLLSVFAIARAYYSER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.79
4 0.85
5 0.87
6 0.85
7 0.88
8 0.88
9 0.83
10 0.78
11 0.74
12 0.64
13 0.59
14 0.57
15 0.56
16 0.56
17 0.56
18 0.57
19 0.58
20 0.61
21 0.61
22 0.64
23 0.62
24 0.61
25 0.64
26 0.65
27 0.65
28 0.65
29 0.65
30 0.63
31 0.63
32 0.54
33 0.49
34 0.45
35 0.38
36 0.39
37 0.4
38 0.38
39 0.33
40 0.39
41 0.42
42 0.5
43 0.58
44 0.6
45 0.59
46 0.62
47 0.68
48 0.68
49 0.66
50 0.62
51 0.56
52 0.53
53 0.51
54 0.46
55 0.41
56 0.37
57 0.32
58 0.27
59 0.25
60 0.25
61 0.3
62 0.36
63 0.4
64 0.43
65 0.53
66 0.6
67 0.64
68 0.62
69 0.56
70 0.53
71 0.48
72 0.47
73 0.47
74 0.47
75 0.48
76 0.52
77 0.48
78 0.45
79 0.44
80 0.38
81 0.29
82 0.22
83 0.18
84 0.15
85 0.17
86 0.16
87 0.15
88 0.14
89 0.13
90 0.11
91 0.08
92 0.07
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06