Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166JW50

Protein Details
Accession A0A166JW50   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-82GENVHAPRRRRVKPPRRRRYHRGETPEFVRBasic
NLS Segment(s)
PositionSequence
59-75PRRRRVKPPRRRRYHRG
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MMEARIKELNWLQEFGSLDFDNDSSEADEDVYDDDDDDFPDDSSMPDLETEVGENVHAPRRRRVKPPRRRRYHRGETPEFVRRMMPRAYRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.28
4 0.19
5 0.17
6 0.17
7 0.16
8 0.13
9 0.12
10 0.12
11 0.08
12 0.08
13 0.08
14 0.07
15 0.07
16 0.06
17 0.07
18 0.07
19 0.06
20 0.06
21 0.07
22 0.07
23 0.07
24 0.08
25 0.07
26 0.06
27 0.07
28 0.06
29 0.06
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.04
41 0.05
42 0.06
43 0.13
44 0.17
45 0.19
46 0.27
47 0.36
48 0.42
49 0.52
50 0.62
51 0.66
52 0.74
53 0.83
54 0.86
55 0.88
56 0.92
57 0.92
58 0.91
59 0.91
60 0.9
61 0.89
62 0.85
63 0.8
64 0.77
65 0.77
66 0.67
67 0.56
68 0.51
69 0.43
70 0.41
71 0.42