Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166AGS2

Protein Details
Accession A0A166AGS2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-35RPKYTRCKTGCLTCRKKKVKCDEAKPDCERCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MQRRRPKYTRCKTGCLTCRKKKVKCDEAKPDCERCQNSGKTCTWPEPTGPRRTPLVADEAVHNWSTDEARPYTASSSAGLSDASSTPSSVPESPHRVVIKYAYTEDRLAPPLPTLSRRHRYYRTLYSQWCRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.79
4 0.78
5 0.82
6 0.84
7 0.85
8 0.84
9 0.86
10 0.86
11 0.85
12 0.86
13 0.86
14 0.85
15 0.86
16 0.83
17 0.78
18 0.72
19 0.7
20 0.62
21 0.55
22 0.55
23 0.52
24 0.51
25 0.51
26 0.48
27 0.46
28 0.46
29 0.46
30 0.42
31 0.37
32 0.35
33 0.38
34 0.42
35 0.46
36 0.45
37 0.43
38 0.4
39 0.4
40 0.38
41 0.29
42 0.28
43 0.19
44 0.18
45 0.17
46 0.16
47 0.17
48 0.15
49 0.14
50 0.09
51 0.09
52 0.09
53 0.08
54 0.09
55 0.09
56 0.1
57 0.1
58 0.11
59 0.11
60 0.11
61 0.11
62 0.09
63 0.1
64 0.09
65 0.09
66 0.08
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.12
76 0.12
77 0.15
78 0.19
79 0.25
80 0.26
81 0.32
82 0.32
83 0.3
84 0.31
85 0.31
86 0.28
87 0.24
88 0.26
89 0.23
90 0.25
91 0.25
92 0.26
93 0.25
94 0.24
95 0.23
96 0.2
97 0.19
98 0.21
99 0.22
100 0.26
101 0.3
102 0.37
103 0.45
104 0.5
105 0.57
106 0.6
107 0.65
108 0.69
109 0.72
110 0.72
111 0.71
112 0.75