Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166LZ68

Protein Details
Accession A0A166LZ68    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-47KTWFDQPGRKLRRRVARKEKAASLGHydrophilic
181-208TSRAEQRYEGARKKRQQKKDEEEAAKKKBasic
NLS Segment(s)
PositionSequence
29-53PGRKLRRRVARKEKAASLGVRPVKS
130-134AKKPK
190-208GARKKRQQKKDEEEAAKKK
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
IPR018256  Ribosomal_L13e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
PROSITE View protein in PROSITE  
PS01104  RIBOSOMAL_L13E  
Amino Acid Sequences MGFGKNNVLHDNHFRKDWQRRVKTWFDQPGRKLRRRVARKEKAASLGVRPVKSLRPAVRGQTVRYNIKLREGRGFTLAELKEAGIGRKEARGVGIVVDHRRRNLSVEGKNLNVERLKAYKERLIVFPRNAKKPKKGDSSADDLKAETTRLPLALPAAFITEEPRKITDEEKGFEAYKTLRTSRAEQRYEGARKKRQQKKDEEEAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.55
4 0.61
5 0.62
6 0.64
7 0.68
8 0.73
9 0.79
10 0.77
11 0.77
12 0.77
13 0.75
14 0.74
15 0.74
16 0.77
17 0.78
18 0.78
19 0.75
20 0.73
21 0.75
22 0.77
23 0.82
24 0.82
25 0.83
26 0.85
27 0.84
28 0.8
29 0.75
30 0.69
31 0.6
32 0.52
33 0.5
34 0.46
35 0.39
36 0.35
37 0.32
38 0.32
39 0.34
40 0.37
41 0.33
42 0.34
43 0.36
44 0.4
45 0.46
46 0.44
47 0.43
48 0.44
49 0.46
50 0.44
51 0.45
52 0.46
53 0.38
54 0.44
55 0.45
56 0.38
57 0.4
58 0.39
59 0.36
60 0.34
61 0.33
62 0.25
63 0.28
64 0.26
65 0.19
66 0.17
67 0.15
68 0.15
69 0.15
70 0.16
71 0.09
72 0.1
73 0.11
74 0.12
75 0.12
76 0.1
77 0.1
78 0.1
79 0.09
80 0.08
81 0.1
82 0.11
83 0.14
84 0.19
85 0.19
86 0.19
87 0.2
88 0.2
89 0.21
90 0.25
91 0.28
92 0.27
93 0.32
94 0.33
95 0.33
96 0.34
97 0.31
98 0.28
99 0.21
100 0.18
101 0.14
102 0.14
103 0.17
104 0.17
105 0.2
106 0.2
107 0.23
108 0.25
109 0.27
110 0.32
111 0.34
112 0.35
113 0.41
114 0.44
115 0.5
116 0.56
117 0.56
118 0.59
119 0.62
120 0.67
121 0.68
122 0.66
123 0.64
124 0.61
125 0.64
126 0.6
127 0.53
128 0.45
129 0.36
130 0.32
131 0.26
132 0.22
133 0.14
134 0.11
135 0.1
136 0.1
137 0.1
138 0.09
139 0.1
140 0.1
141 0.1
142 0.08
143 0.09
144 0.09
145 0.09
146 0.13
147 0.15
148 0.16
149 0.18
150 0.19
151 0.2
152 0.21
153 0.23
154 0.26
155 0.28
156 0.28
157 0.29
158 0.31
159 0.29
160 0.28
161 0.29
162 0.23
163 0.23
164 0.26
165 0.25
166 0.28
167 0.31
168 0.38
169 0.45
170 0.54
171 0.51
172 0.48
173 0.51
174 0.55
175 0.61
176 0.63
177 0.63
178 0.63
179 0.69
180 0.78
181 0.83
182 0.84
183 0.85
184 0.87
185 0.86
186 0.88
187 0.89
188 0.88