Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4UNY7

Protein Details
Accession J4UNY7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-78AYAKVDRPSKRKVRGRKERLEADHRRABasic
NLS Segment(s)
PositionSequence
58-70RPSKRKVRGRKER
Subcellular Location(s) cyto_nucl 14.5, cyto 11.5, nucl 10.5, mito 3
Family & Domain DBs
Amino Acid Sequences MNAGMRLAQDTASAEYVGDLALVGAEKRRDGKEQHAALPTQARQPATNAGQAYAKVDRPSKRKVRGRKERLEADHRRAFTLTDICYHCAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.07
6 0.04
7 0.03
8 0.03
9 0.04
10 0.04
11 0.06
12 0.07
13 0.08
14 0.12
15 0.14
16 0.18
17 0.2
18 0.28
19 0.35
20 0.37
21 0.41
22 0.4
23 0.38
24 0.35
25 0.36
26 0.3
27 0.24
28 0.23
29 0.19
30 0.17
31 0.18
32 0.22
33 0.19
34 0.21
35 0.18
36 0.16
37 0.16
38 0.16
39 0.17
40 0.15
41 0.15
42 0.15
43 0.2
44 0.25
45 0.29
46 0.39
47 0.46
48 0.54
49 0.61
50 0.69
51 0.75
52 0.8
53 0.86
54 0.86
55 0.86
56 0.85
57 0.84
58 0.83
59 0.8
60 0.78
61 0.74
62 0.65
63 0.59
64 0.5
65 0.43
66 0.38
67 0.35
68 0.28
69 0.28
70 0.29