Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YNB6

Protein Details
Accession A0A165YNB6   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAQRVTLRKRQPYNTKSNRRRVVKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTKSNRRRVVKTPGGILRYHHIKKLPTAPKCGDCGIKLPGVVALRPREYATVSKTSKTVQRAYGGSRCGDCVRSRVVRAFLIEEAKVVKRVIKQQKAGGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.89
5 0.89
6 0.86
7 0.83
8 0.79
9 0.79
10 0.76
11 0.7
12 0.67
13 0.62
14 0.57
15 0.52
16 0.46
17 0.41
18 0.42
19 0.4
20 0.35
21 0.33
22 0.33
23 0.37
24 0.45
25 0.48
26 0.42
27 0.47
28 0.48
29 0.47
30 0.48
31 0.45
32 0.36
33 0.28
34 0.28
35 0.23
36 0.2
37 0.17
38 0.15
39 0.15
40 0.14
41 0.14
42 0.14
43 0.14
44 0.14
45 0.14
46 0.15
47 0.13
48 0.14
49 0.16
50 0.16
51 0.23
52 0.23
53 0.23
54 0.24
55 0.25
56 0.28
57 0.3
58 0.31
59 0.25
60 0.29
61 0.3
62 0.34
63 0.36
64 0.33
65 0.3
66 0.27
67 0.26
68 0.23
69 0.24
70 0.21
71 0.19
72 0.24
73 0.26
74 0.28
75 0.3
76 0.32
77 0.31
78 0.32
79 0.32
80 0.28
81 0.27
82 0.24
83 0.2
84 0.2
85 0.2
86 0.21
87 0.18
88 0.2
89 0.23
90 0.33
91 0.43
92 0.49
93 0.53
94 0.59