Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166B3P9

Protein Details
Accession A0A166B3P9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-76EPVPRSYPLPQRQRKPVQGFEDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 7, E.R. 4, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MASVGNPFSRTLRYMQWAAHEKPALFFAVAIASTAPVIMVVGNVLKSSGKYVAPEPVPRSYPLPQRQRKPVQGFEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.34
4 0.39
5 0.39
6 0.42
7 0.39
8 0.34
9 0.33
10 0.32
11 0.25
12 0.18
13 0.15
14 0.1
15 0.08
16 0.08
17 0.07
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.03
24 0.03
25 0.02
26 0.02
27 0.02
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.06
35 0.08
36 0.08
37 0.1
38 0.12
39 0.17
40 0.2
41 0.25
42 0.27
43 0.29
44 0.3
45 0.31
46 0.34
47 0.34
48 0.41
49 0.46
50 0.54
51 0.58
52 0.65
53 0.73
54 0.79
55 0.83
56 0.82
57 0.81