Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165X2U3

Protein Details
Accession A0A165X2U3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-118SLPSKSFQGRRTDRKRKLANPVAQHREDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MKDKSSPTAATSKTRSKSYELGGMSEDPSWREQTKRNVSQKDTPSRSADIEQGRFKSGMSCYNCRDDHVKCQKTLGASSCNYCLKHSWECSLPSKSFQGRRTDRKRKLANPVAQHREDVMKAEASETS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.48
4 0.5
5 0.47
6 0.47
7 0.39
8 0.36
9 0.33
10 0.32
11 0.28
12 0.24
13 0.2
14 0.14
15 0.16
16 0.18
17 0.18
18 0.2
19 0.25
20 0.34
21 0.44
22 0.53
23 0.6
24 0.63
25 0.66
26 0.72
27 0.74
28 0.74
29 0.68
30 0.62
31 0.56
32 0.51
33 0.48
34 0.41
35 0.38
36 0.32
37 0.32
38 0.32
39 0.29
40 0.29
41 0.27
42 0.25
43 0.22
44 0.18
45 0.21
46 0.23
47 0.25
48 0.26
49 0.32
50 0.32
51 0.31
52 0.33
53 0.28
54 0.34
55 0.41
56 0.41
57 0.36
58 0.37
59 0.37
60 0.34
61 0.35
62 0.28
63 0.22
64 0.2
65 0.21
66 0.24
67 0.26
68 0.25
69 0.24
70 0.23
71 0.23
72 0.28
73 0.29
74 0.28
75 0.28
76 0.32
77 0.37
78 0.4
79 0.36
80 0.33
81 0.37
82 0.4
83 0.44
84 0.45
85 0.5
86 0.54
87 0.63
88 0.72
89 0.77
90 0.79
91 0.83
92 0.87
93 0.84
94 0.86
95 0.85
96 0.82
97 0.81
98 0.82
99 0.8
100 0.72
101 0.65
102 0.56
103 0.5
104 0.43
105 0.36
106 0.29
107 0.23
108 0.22