Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166DK01

Protein Details
Accession A0A166DK01    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
181-203TRGPVPQVVKPRKKKRAEEDEDABasic
NLS Segment(s)
PositionSequence
190-196KPRKKKR
Subcellular Location(s) mito 12, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019446  BMT5-like  
Gene Ontology GO:0070042  F:rRNA (uridine-N3-)-methyltransferase activity  
GO:0070475  P:rRNA base methylation  
Pfam View protein in Pfam  
PF10354  BMT5-like  
Amino Acid Sequences MAKGAKKKLQSALISQQTRLKKNAEAKAAGQVNEQKDRVKKSTSTRRSTIPFMPTDRILLVGEGDFSFAHALVLHPPEALEHLPSSNVVATAYDTEAECYEKYPGASEHVAALREKGATVLFGVDAAKLDKHPFLTKGKRFDRIVWNFPHAGKGIADQDRNIRANQELLLGFLRSAPDVLTRGPVPQVVKPRKKKRAEEDEDADERMSGDETPPGADAGGARGTLLVTLRNVAPYTDWDLPRLAKNPPAPKANEKLVRYKQLRSFVFNRKDWRGYAHRMTKGDRAHGTGTTGQGGEDRTWEFCMRYEDEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.57
4 0.56
5 0.57
6 0.53
7 0.46
8 0.44
9 0.52
10 0.57
11 0.57
12 0.53
13 0.5
14 0.55
15 0.55
16 0.48
17 0.43
18 0.42
19 0.4
20 0.43
21 0.43
22 0.4
23 0.42
24 0.48
25 0.48
26 0.47
27 0.48
28 0.53
29 0.63
30 0.67
31 0.69
32 0.65
33 0.68
34 0.67
35 0.66
36 0.62
37 0.57
38 0.51
39 0.48
40 0.48
41 0.42
42 0.39
43 0.33
44 0.28
45 0.22
46 0.17
47 0.14
48 0.1
49 0.11
50 0.09
51 0.09
52 0.07
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.09
60 0.11
61 0.11
62 0.1
63 0.1
64 0.1
65 0.12
66 0.12
67 0.1
68 0.09
69 0.09
70 0.1
71 0.1
72 0.11
73 0.09
74 0.09
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.07
82 0.08
83 0.08
84 0.1
85 0.09
86 0.09
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.14
93 0.14
94 0.14
95 0.15
96 0.16
97 0.17
98 0.15
99 0.15
100 0.12
101 0.11
102 0.11
103 0.09
104 0.07
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.06
116 0.08
117 0.08
118 0.1
119 0.12
120 0.15
121 0.22
122 0.31
123 0.36
124 0.44
125 0.46
126 0.51
127 0.51
128 0.53
129 0.56
130 0.53
131 0.53
132 0.47
133 0.46
134 0.41
135 0.4
136 0.36
137 0.25
138 0.2
139 0.15
140 0.13
141 0.15
142 0.17
143 0.17
144 0.15
145 0.18
146 0.22
147 0.23
148 0.21
149 0.17
150 0.14
151 0.15
152 0.15
153 0.14
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.08
160 0.08
161 0.06
162 0.06
163 0.05
164 0.06
165 0.07
166 0.07
167 0.09
168 0.09
169 0.1
170 0.1
171 0.12
172 0.13
173 0.15
174 0.26
175 0.34
176 0.43
177 0.53
178 0.63
179 0.71
180 0.78
181 0.83
182 0.83
183 0.84
184 0.82
185 0.8
186 0.74
187 0.71
188 0.63
189 0.55
190 0.45
191 0.33
192 0.26
193 0.18
194 0.14
195 0.07
196 0.06
197 0.07
198 0.08
199 0.08
200 0.08
201 0.08
202 0.07
203 0.07
204 0.07
205 0.07
206 0.08
207 0.07
208 0.06
209 0.07
210 0.07
211 0.07
212 0.08
213 0.07
214 0.06
215 0.08
216 0.08
217 0.1
218 0.1
219 0.1
220 0.1
221 0.12
222 0.17
223 0.22
224 0.22
225 0.22
226 0.24
227 0.26
228 0.29
229 0.29
230 0.26
231 0.26
232 0.33
233 0.4
234 0.44
235 0.48
236 0.49
237 0.53
238 0.57
239 0.6
240 0.6
241 0.55
242 0.6
243 0.61
244 0.66
245 0.63
246 0.64
247 0.62
248 0.63
249 0.63
250 0.6
251 0.61
252 0.61
253 0.66
254 0.64
255 0.65
256 0.63
257 0.64
258 0.58
259 0.58
260 0.55
261 0.55
262 0.59
263 0.61
264 0.6
265 0.6
266 0.63
267 0.63
268 0.6
269 0.59
270 0.52
271 0.47
272 0.43
273 0.4
274 0.4
275 0.35
276 0.32
277 0.27
278 0.24
279 0.2
280 0.19
281 0.2
282 0.17
283 0.17
284 0.17
285 0.16
286 0.2
287 0.21
288 0.2
289 0.22
290 0.27