Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166I085

Protein Details
Accession A0A166I085   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-33EPKQTLTPSRKHRKMLKNGQGEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000818  TEA/ATTS_dom  
IPR038096  TEA/ATTS_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF01285  TEA  
PROSITE View protein in PROSITE  
PS51088  TEA_2  
Amino Acid Sequences SSRSRLSHLSEPKQTLTPSRKHRKMLKNGQGEVWPEYIEEVFVEGLRAYWRSSSVSFQSGRSRERNDFIVKYLGEMKIERTKKQVASHIQVLRSMWGKPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.48
4 0.49
5 0.53
6 0.6
7 0.64
8 0.69
9 0.78
10 0.79
11 0.83
12 0.85
13 0.84
14 0.82
15 0.76
16 0.7
17 0.63
18 0.55
19 0.46
20 0.35
21 0.26
22 0.16
23 0.15
24 0.13
25 0.09
26 0.07
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.07
38 0.09
39 0.1
40 0.12
41 0.13
42 0.17
43 0.17
44 0.19
45 0.25
46 0.27
47 0.3
48 0.32
49 0.35
50 0.34
51 0.36
52 0.39
53 0.37
54 0.35
55 0.33
56 0.33
57 0.28
58 0.27
59 0.28
60 0.24
61 0.2
62 0.19
63 0.22
64 0.27
65 0.3
66 0.3
67 0.32
68 0.37
69 0.41
70 0.46
71 0.5
72 0.49
73 0.53
74 0.6
75 0.6
76 0.55
77 0.52
78 0.47
79 0.42
80 0.36