Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166A6R8

Protein Details
Accession A0A166A6R8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21NGREKKPRKINEPFRRVRAEEBasic
55-76TRGDGFRKEKNKKKRGSYRGGDBasic
NLS Segment(s)
PositionSequence
61-70RKEKNKKKRG
Subcellular Location(s) cyto_nucl 12.333, cyto 12, nucl 11.5, cyto_mito 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences NGREKKPRKINEPFRRVRAEEITFEHPELADNTFESRRATMNDYGAKASADLIVTRGDGFRKEKNKKKRGSYRGGDITVRLYACRVAWVQTLICCIVADPELQVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.73
4 0.68
5 0.64
6 0.56
7 0.49
8 0.46
9 0.45
10 0.4
11 0.38
12 0.32
13 0.24
14 0.22
15 0.19
16 0.16
17 0.1
18 0.09
19 0.12
20 0.13
21 0.14
22 0.13
23 0.13
24 0.13
25 0.15
26 0.18
27 0.18
28 0.22
29 0.24
30 0.24
31 0.24
32 0.23
33 0.2
34 0.16
35 0.14
36 0.1
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.09
46 0.12
47 0.18
48 0.28
49 0.37
50 0.46
51 0.57
52 0.66
53 0.71
54 0.79
55 0.83
56 0.83
57 0.83
58 0.79
59 0.78
60 0.75
61 0.7
62 0.6
63 0.5
64 0.42
65 0.35
66 0.3
67 0.21
68 0.14
69 0.13
70 0.12
71 0.15
72 0.13
73 0.13
74 0.15
75 0.17
76 0.18
77 0.18
78 0.2
79 0.17
80 0.17
81 0.15
82 0.13
83 0.12
84 0.12
85 0.11