Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166IGH8

Protein Details
Accession A0A166IGH8   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
198-218EEFFRLKKVQGKKKRDTEAAEHydrophilic
NLS Segment(s)
PositionSequence
204-223KKVQGKKKRDTEAAENKRKK
Subcellular Location(s) nucl 11, cyto 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002699  V_ATPase_D  
Gene Ontology GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF01813  ATP-synt_D  
Amino Acid Sequences MSGTGPRENIFPTRMALTNTKLRLKGAQTGHSLLAKKRDALTTRFRAILRKVDEAKRKMGRVMQLASFSLAEVTYATGDISYLVQEQAKQATFRVKAKQENVSGVVLPAFEVDRVQGSDFNLTGLGRGGQQVIRSKEVYAKAVETLVELASLQTAFMILDEVIRATNRRVNAIEHVVIPRLDNTIKYIMSELDEMDREEFFRLKKVQGKKKRDTEAAENKRKKDLAAAAATADEAEGQAAAPPSIVDEEPGEAAGDLLNDKDTDVIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.3
5 0.36
6 0.41
7 0.44
8 0.42
9 0.41
10 0.44
11 0.43
12 0.46
13 0.43
14 0.44
15 0.42
16 0.44
17 0.45
18 0.43
19 0.42
20 0.37
21 0.4
22 0.35
23 0.34
24 0.34
25 0.39
26 0.38
27 0.41
28 0.48
29 0.47
30 0.48
31 0.49
32 0.47
33 0.46
34 0.46
35 0.49
36 0.44
37 0.45
38 0.48
39 0.52
40 0.61
41 0.58
42 0.63
43 0.6
44 0.57
45 0.53
46 0.51
47 0.49
48 0.45
49 0.45
50 0.39
51 0.34
52 0.33
53 0.31
54 0.26
55 0.2
56 0.14
57 0.1
58 0.08
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.08
74 0.11
75 0.12
76 0.12
77 0.13
78 0.19
79 0.23
80 0.26
81 0.32
82 0.34
83 0.39
84 0.43
85 0.48
86 0.43
87 0.42
88 0.4
89 0.34
90 0.29
91 0.23
92 0.19
93 0.12
94 0.1
95 0.07
96 0.05
97 0.04
98 0.04
99 0.04
100 0.05
101 0.06
102 0.06
103 0.07
104 0.08
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.07
111 0.06
112 0.06
113 0.05
114 0.05
115 0.06
116 0.06
117 0.09
118 0.14
119 0.16
120 0.18
121 0.18
122 0.18
123 0.22
124 0.22
125 0.22
126 0.17
127 0.16
128 0.14
129 0.14
130 0.13
131 0.09
132 0.08
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.03
146 0.03
147 0.04
148 0.04
149 0.04
150 0.05
151 0.06
152 0.07
153 0.1
154 0.11
155 0.13
156 0.14
157 0.16
158 0.2
159 0.23
160 0.22
161 0.21
162 0.21
163 0.2
164 0.19
165 0.17
166 0.14
167 0.12
168 0.12
169 0.11
170 0.13
171 0.15
172 0.15
173 0.15
174 0.15
175 0.13
176 0.14
177 0.14
178 0.11
179 0.1
180 0.11
181 0.11
182 0.11
183 0.11
184 0.1
185 0.11
186 0.13
187 0.12
188 0.17
189 0.19
190 0.23
191 0.31
192 0.4
193 0.5
194 0.58
195 0.68
196 0.72
197 0.79
198 0.81
199 0.8
200 0.77
201 0.76
202 0.77
203 0.78
204 0.79
205 0.76
206 0.71
207 0.7
208 0.65
209 0.55
210 0.51
211 0.46
212 0.43
213 0.4
214 0.39
215 0.33
216 0.32
217 0.31
218 0.24
219 0.17
220 0.09
221 0.05
222 0.04
223 0.04
224 0.04
225 0.06
226 0.07
227 0.07
228 0.07
229 0.07
230 0.08
231 0.1
232 0.1
233 0.09
234 0.1
235 0.11
236 0.12
237 0.12
238 0.11
239 0.09
240 0.09
241 0.08
242 0.08
243 0.07
244 0.07
245 0.08
246 0.07
247 0.08