Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166D5B2

Protein Details
Accession A0A166D5B2   
Localization Confidence High
Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRAAKLCKRPKKAPTPAQGSSKHydrophilic
NLS Segment(s)
PositionSequence
9-18KRPKKAPTPA
23-23K
28-62APSSKSKIKAPESAVELARKQAGLKAKAAAYKRKP
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MGRAAKLCKRPKKAPTPAQGSSKIPTSAPSSKSKIKAPESAVELARKQAGLKAKAAAYKRKPGSEGPVLGGADYVGAMFGGRRRARVEAEKMPLDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.83
4 0.8
5 0.78
6 0.72
7 0.64
8 0.55
9 0.49
10 0.4
11 0.31
12 0.28
13 0.28
14 0.3
15 0.31
16 0.35
17 0.36
18 0.41
19 0.45
20 0.47
21 0.48
22 0.46
23 0.48
24 0.46
25 0.45
26 0.42
27 0.41
28 0.38
29 0.32
30 0.28
31 0.22
32 0.19
33 0.15
34 0.12
35 0.12
36 0.16
37 0.16
38 0.17
39 0.18
40 0.19
41 0.23
42 0.26
43 0.32
44 0.31
45 0.38
46 0.4
47 0.4
48 0.41
49 0.39
50 0.43
51 0.4
52 0.37
53 0.3
54 0.31
55 0.29
56 0.26
57 0.24
58 0.16
59 0.1
60 0.08
61 0.06
62 0.03
63 0.03
64 0.03
65 0.04
66 0.06
67 0.15
68 0.16
69 0.19
70 0.22
71 0.26
72 0.32
73 0.4
74 0.46
75 0.45
76 0.51
77 0.53